Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T4 Olfactory Receptor

Gene Symbol OR2T41 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR1-60, HsOR1.5.37, ORL3003
External Ids HGNC: 15016   GeneBank: AB065615, BK004464, NM_001004696   ORDB: ORL3003   
Build #39 labels OR2T4
Chromosomal location 1:248,361,635-248,362,624 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T29 91.8% 305
OR2T5 91.48% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T4 85% 320
Dog OR2T4C 83% 320
Dog OR2T4D 81% 320
Dog OR2T4B 80% 320
Chimp CONTIG1126.46-6307 96% 330
Mouse Or2t29 79% 313
Rat Or2t29 78% 313
Cow OR2T4 82% 320
Cow OR2T29 83% 311
Cow OR2T29C 81% 312

Expression evidences

Source Accession
GNF Atlas2 gnf1h02155_at
GNF Atlas2 gnf1h10657_s_at
GNF Atlas2 gnf1h10658_at

Sequence information

Nucleotide sequence ATGGGACTCTTCAGACAATCCAAACATCCAATGGCCAATATCACCTGGATGGCCAACCAC
ACTGGATGGTCGGATTTCATCCTGTTGGGACTCTTCAGACAATCCAAACATCCAGCACTA
CTTTGTGTGGTCATTTTTGTGGTTTTCCTGATGGCGTTGTCTGGAAATGCTGTCCTGATC
CTTCTGATACACTGTGACGCCCACCTCCACACCCCCATGTACTTTTTCATCAGTCAATTG
TCTCTCATGGACATGGCGTACATTTCTGTCACTGTGCCCAAGATGCTCCTGGACCAGGTC
ATGGGTGTGAATAAGATCTCAGCCCCTGAGTGTGGGATGCAGATGTTCTTCTACGTGACA
CTAGCAGGTTCAGAATTTTTCCTTCTAGCCACCATGGCCTATGACCGCTACGTGGCCATC
TGCCATCCTCTCCGTTACCCTGTCCTCATGAACCATAGGGTGTGTCTCTTCCTGTCATCA
GGCTGCTGGTTCCTGGGCTCAGTGGATGGCTTCACATTCACTCCCATCACCATGACCTTC
CCCTTCCGTGGATCCCGGGAGATTCATCATTTCTTCTGTGAAGTTCCTGCTGTATTGAAT
CTCTCCTGCTCAGACACCTCACTCTATGAGATTTTCATGTACTTGTGCTGTGTCCTCATG
CTCCTCATCCCTGTGGTGATCATTTCAAGCTCCTATTTACTCATCCTCCTCACCATCCAC
GGGATGAACTCAGCAGAGGGCCGGAAAAAGGCCTTTGCCACCTGCTCCTCCCACCTGACT
GTGGTCATCCTCTTCTATGGGGCTGCCATCTACACCTACATGCTCCCCAGCTCCTACCAC
ACCCCTGAGAAGGACATGATGGTATCTGTCTTCTATACCATCCTCACTCCAGTGGTGAAC
CCTTTAATCTATAGTCTTAGGAATAAGGATGTCATGGGGGCTCTGAAGAAAATGTTAACA
GTGGAACCTGCCTTTCAAAAAGCTATGGAG
Conceptual translation MGLFRQSKHPMANITWMANHTGWSDFILLGLFRQSKHPALLCVVIFVVFLMALSGNAVLI
LLIHCDAHLHTPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKISAPECGMQMFFYVT
LAGSEFFLLATMAYDRYVAICHPLRYPVLMNHRVCLFLSSGCWFLGSVDGFTFTPITMTF
PFRGSREIHHFFCEVPAVLNLSCSDTSLYEIFMYLCCVLMLLIPVVIISSSYLLILLTIH
GMNSAEGRKKAFATCSSHLTVVILFYGAAIYTYMLPSSYHTPEKDMMVSVFYTILTPVVN
PLIYSLRNKDVMGALKKMLTVEPAFQKAME

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A G/E 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN A/T A/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 248,361,751 248,361,751 SYN A/T A/A 1000GP (CEU, CHBJPT)
1 248,361,758 248,361,758 NS T/A C/S 1000GP (CEU, CHBJPT)
1 248,361,769 248,361,769 SYN T/C I/I 1000GP (CEU, CHBJPT)
1 248,361,784 248,361,784 SYN G/A L/L 1000GP (CEU)
1 248,361,798 248,361,798 NS G/A G/E 1000GP (CEU)
1 248,361,833 248,361,833 NS G/A A/T 1000GP (CHBJPT)
1 248,361,836 248,361,836 NS C/T H/Y 1000GP (CEU, CHBJPT)
1 248,361,844 248,361,844 SYN C/T H/H 1000GP (CEU, CHBJPT)
1 248,361,983 248,361,983 NS T/C F/L 1000GP (CEU, CHBJPT)
1 248,361,988 248,361,988 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
1 248,361,989 248,361,989 NS G/C V/L 1000GP (CEU, CHBJPT)
1 248,362,345 248,362,345 SYN C/A L/L 1000GP (CEU, CHBJPT)
1 248,362,348 248,362,348 SYN C/T T/T 1000GP (CEU, CHBJPT)
1 248,362,355 248,362,355 NS G/A G/R 1000GP (CEU, CHBJPT)
1 248,524,967 248,525,050 Del(83) Del rs71811615 (DbSNP)
1 248,524,971 248,524,971 NS A/C D/A rs45554631 (DbSNP)
1 248,524,974 248,524,974 NS A/G N/S rs57795102 (DbSNP)
1 248,524,975 248,524,975 SYN C/T N/N rs45627735 (DbSNP)
1 248,524,992 248,524,992 NS A/G N/S rs45552134 (DbSNP)
1 248,525,021 248,525,021 NS A/T M/L rs45438195 (DbSNP)
1 248,525,053 248,525,053 SYN A/T A/A rs28415565 (DbSNP)
1 248,525,060 248,525,060 NS A/T S/C rs28491677 (DbSNP)
1 248,525,071 248,525,071 SYN C/T I/I rs28499298 (DbSNP)
1 248,525,086 248,525,086 SYN A/G L/L rs45604640 (DbSNP)
1 248,525,100 248,525,100 NS A/G E/G rs73146195 (DbSNP)
1 248,525,143 248,525,143 SYN C/T L/L rs34261040 (DbSNP)
1 248,525,146 248,525,146 SYN C/T H/H rs28482938 (DbSNP)
1 248,525,193 248,525,193 NS C/T A/V rs28655275 (DbSNP)
1 248,525,285 248,525,285 NS C/T L/F rs28637620 (DbSNP)
1 248,525,285 248,525,286 Del(2) -/TT rs58006779 (DbSNP)
1 248,525,289 248,525,289 Del(1) -/A rs61131289 (DbSNP)
1 248,525,291 248,525,291 Del(1) -/G rs57728407 (DbSNP)
1 248,525,291 248,525,291 NS C/G L/V rs28540568 (DbSNP)
1 248,525,329 248,525,328 Ins(2) -/TA rs61248663 (DbSNP)
1 248,525,330 248,525,330 NS A/G M/V rs56721857 (DbSNP)
1 248,525,353 248,525,353 SYN C/T A/A rs41308198 (DbSNP)
1 248,525,536 248,525,536 SYN C/T N/N rs61299560 (DbSNP)
1 248,525,639 248,525,639 Del(1) -/A rs34079073 (DbSNP)
1 248,525,647 248,525,647 SYN A/C L/L rs28405645 (DbSNP)
1 248,525,650 248,525,650 SYN C/T T/T rs28602650 (DbSNP)
1 248,525,657 248,525,657 NS A/G R/G rs28718027 (DbSNP)
1 248,525,780 248,525,780 NS C/T P/S rs28698997 (DbSNP)
1 248,525,847 248,525,847 NS A/G Y/C rs74153570 (DbSNP)
1 248,525,913 248,525,913 Del(1) -/A rs35286335 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,242,528 248,817,382 CopyNumber Variation_8935 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,524,640 248,524,963 InDel Variation_33214 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N3S N9S L19M C32S G45E R173H G231R P272S Y294C R297K M319I % Freq CORP
1 N N L C G R G P Y R M 58.99 0.293
2 N N L C E R G P Y R M 11.98 0.293
3 N N L C G R R S Y R M 6.84 0.293
4 S N L S G R R S Y R M 4.53 0.293
5 N N M S G R R S Y R M 2.61 0.293
6 N N L C E R R S Y R M 2.07 0.293
7 N S M S G R R S Y R M 1.92 0.293
8 S N L C G R R S Y R M 1.69 0.293
9 N N M S E R R S Y R M 1.15 0.293
10 N N L C G R G S Y R M 1.15 0.293
11 S N L S E R R S Y R M 1.08 0.293
12 N S M S E R R S Y R M 0.69 0.293
13 N S M C G R R S Y R M 0.61 0.293
14 N N L S G R R S Y R M 0.61 0.293
15 N N L C E R G S Y R M 0.46 0.293
16 N N M C G R R S Y R M 0.46 0.293
17 N N M C E R R S Y R M 0.31 0.293
18 N N L C E R G P Y R I 0.31 0.293
19 N N L C G R R P Y R M 0.31 0.293
20 N S M C E R R S Y R M 0.31 0.293
21 N S L C G R R S Y R M 0.31 0.293
22 S N L C E R R S Y R M 0.23 0.293
23 N N L C G R G P C R M 0.23 0.293
24 N N L S E R R S Y R M 0.15 0.293
25 N N M S G R G S Y R M 0.15 0.293
26 N N L C E R G P Y K M 0.15 0.293
27 N N L C G H R S Y R M 0.08 0.293
28 N N M S E R G S Y R M 0.08 0.293
29 N N L S G R G S Y R M 0.08 0.293
30 S N L S G R G S Y R M 0.08 0.293
31 N N L S E R G S Y R M 0.08 0.293
32 N N L C E R G P C R M 0.08 0.293
33 N S M S G R G S Y R M 0.08 0.293
34 N N L S G R G P Y R M 0.08 0.293
35 S N L S G R R P Y R M 0.08 0.293

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T4.aApr07-unspliced main_exon 5UTR chr1 248,361,581 248,361,635 +
CDS chr1 248,361,635 248,362,624 +
3UTR chr1 248,362,624 248,362,627 +