Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2T8 Olfactory Receptor

Gene Symbol OR2T81 (View this gene in GeneCards)
Family 2
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.13 (functional)
Aliases HsOR1.5.16
External Ids HGNC: 15020   GeneBank: AF399488, NM_001005522   
Build #39 labels OR2T8P
Chromosomal location 1:247,921,018-247,921,953 (+)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2T12 90.06% 312
OR2T32P 91.99% 312
OR2T33 93.59% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2T15 77% 312
Chimp CONTIG*********** 93% 312
Chimp CONTIG1126.4-2200 90% 312
Mouse Or2t44 74% 312
Rat Or2t44 72% 312
Cow OR2T13 75% 312

Expression evidences

Source Accession
ESTs BF849296

Sequence information

Nucleotide sequence ATGGAAAATGGGAGCTATACCTCTTATTTCATTCTCCTAGGACTCTTTAACCACACCAGA
GCCCACCAAGTCCTCTTCATGATGGTTCTGAGTATCGTTTTGACCTCCCTGTTTGGCAAT
TCCCTCATGATTCTCCTGATTCACTGGGACCACCGGCTCCACACGCCCATGTACTTCCTC
CTGAGCCAACTTTCCCTCATGGACGTGATGCTGGTTTCCACCACTGTGCCCAAAATGGCG
GCTGACTACTTGACCGGAAGTAAGGCCATCTCCCGCGCTGGCTGTGGTGCGCAGATCTTC
TTCCTCCCCACACTGGGTGGTGGAGAGTGCTTCCTCTTAGCAGCCATGGCCTATGACCGC
TATGCGGCTGTCTGCCACCCACTCCGATATCCCACTCTCATGAGCTGGCAGCTGTGCCTG
AGGATGAACCTGTCGTGTTGGCTCCTGGGTGCAGCTGACGGGCTCCTGCAGGCTGTTGCT
ACCCTGAGCTTCCCATATTGCGGTGCACACGAGATCGATCACTTCTTCTGCGAGACCCCC
GTGCTGGTGCGTTTGGCTTGTGCTGACACTTCAGTCTTCGAAAACGCCATGTACATCTGC
TGTGTGTTAATGCTCCTGGTCCCCTTTTCCCTCATCCTGTCCTCCTATGGTCTCATCCTC
GCTGCTGTTCTGCACATGCGCTCTACAGAAGCCCGCAAGAAGGCCTTTGCCACCTGCTCT
TCACATGTGGCTGTGGTGGGACTCTTTTATGGAGCTGCCATTTTTACCTATATGAGACCC
AAATCCCACAGGTCCACTAACCACGACAAGGTTGTGTCAGCCTTCTATACTATGTTCACC
CCTTTACTAAACCCCCTCATCTACAGTGTGAAGAACAGTGAGGTGAAGGGAGCCCTGACA
AGGTGTATGGGTCGGTGTGTGGCCTTAAGTCGTGAA
Conceptual translation MENGSYTSYFILLGLFNHTRAHQVLFMMVLSIVLTSLFGNSLMILLIHWDHRLHTPMYFL
LSQLSLMDVMLVSTTVPKMAADYLTGSKAISRAGCGAQIFFLPTLGGGECFLLAAMAYDR
YAAVCHPLRYPTLMSWQLCLRMNLSCWLLGAADGLLQAVATLSFPYCGAHEIDHFFCETP
VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLHMRSTEARKKAFATCS
SHVAVVGLFYGAAIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVKNSEVKGALT
RCMGRCVALSRE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/T R/W 1000GP (YRI, YRI)
1 247,921,930 247,921,930 NS C/T R/W 1000GP (CHBJPT)
1 248,084,434 248,084,434 NS A/G S/G rs11204563 (DbSNP)
1 248,084,464 248,084,464 NS C/T R/W rs11204564 (DbSNP)
1 248,084,511 248,084,511 SYN C/T L/L rs41315864 (DbSNP)
1 248,084,524 248,084,524 NS A/G M/V rs28575687 (DbSNP)
1 248,084,589 248,084,589 SYN C/T I/I rs41305969 (DbSNP)
1 248,084,625 248,084,625 SYN C/G L/L rs6692365 (DbSNP)
1 248,084,627 248,084,627 NS C/T P/L rs61857490 (DbSNP)
1 248,084,631 248,084,631 SYN A/C T/T rs28689982 (DbSNP)
1 248,084,747 248,084,747 NS A/C N/T rs4523549 (DbSNP)
1 248,084,749 248,084,749 NS A/C M/L rs12142488 (DbSNP)
1 248,084,825 248,084,825 NS C/T A/V rs61857492 (DbSNP)
1 248,084,854 248,084,854 NS A/G T/A rs4584426 (DbSNP)
1 248,084,909 248,084,909 NS G/T R/M rs34508376 (DbSNP)
1 248,084,980 248,084,980 NS G/T A/S rs4362017 (DbSNP)
1 248,085,011 248,085,011 NS C/G A/G rs4595394 (DbSNP)
1 248,085,108 248,085,108 SYN C/T H/H rs4625315 (DbSNP)
1 248,085,124 248,085,124 NS A/G N/D rs4590708 (DbSNP)
1 248,085,232 248,085,232 NS C/T R/W rs6695357 (DbSNP)
1 248,085,251 248,085,251 NS A/G H/R rs58882030 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M1T T277S R305W R311H % Freq CORP
1 M T R R 85.10 0.285
2 M S R R 9.60 0.285
3 M T R H 3.46 0.285
4 M T W R 1.46 0.285
5 T T R R 0.31 1.200
6 T T R H 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2T8.aApr07 exon_5UTR chr1 247,920,250 247,920,518 +
main_exon 5UTR chr1 247,920,998 247,921,018 +
CDS chr1 247,921,018 247,921,953 +
3UTR chr1 247,921,953 247,921,956 +