Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2U2P Olfactory Receptor

Gene Symbol OR2U2P1 (View this gene in GeneCards)
Family 2
Subfamily U
Pseudogene Yes
CORP pseudogene probability score
Aliases hs6M1-23, OR6-24, AL050339-B, dJ974I11.2, HsOR6.3.14P, ORL3153
External Ids HGNC: 8279   GeneBank: BK004666, NG_004687   ORDB: ORL3153   
Build #39 labels OR2U2P
Chromosomal location 6:29,268,477-29,269,421 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2U1P 70.19% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W1 54% 304
Mouse Or2w4 55% 308
Rat Or2w1c 54% 304
Cow OR2U2 84% 311
Orang OR2W4 52% 308
Horse OR2U1 77% 315
Chimp OR2W1 55% 304

Sequence information

Nucleotide sequence ATGATCAATGATAGCCACTTCAGTGGTTTTATACTCCTTGGATTCACAGGGCAGCCTCAG
CTTCAGATGATGATCTCTGGGGTTGTCTTTTTCTTCTACACTATTGCCTTCATGGGAAAT
ATGGCCATCATCCTATTGTCTTTCCTAGATGACCATCTCCAAGTCCCCATGTACTTCTTC
CTTAGAAATTTGGCCATCTTGGATCTCTGTTATACCACAAATATAGTCCCACAAATGTTG
GTCAGTATCTGGGGCAAAGACAAAAGAATTACCTTTGGTGGGTGTGCCTTTCAACTTTTC
ATTGATGTGGCACTGTACTCAGTTGAATGCATCCTTCTGTCCATGATGTCATATGATCGA
CTCAATGCTATCTGCAAGCCTCTGCATCATATGACCATAATGAACCTCCAACTCTGCCAG
GGCCTTGTGGTCATCTCCTGGGTAGTTGGTGTGATTAATTGCATCATACCTTCCCCTTAT
GCCACGAGTCTTCCTCGATGTAGGAACCACCACCTAGACCACTTTTTTGTGTGTGTGAAA
TGTCTGCAATGATCAAGATTCAAGATTGCATGTGTGGACACCACAGCCATGGAGGTAACC
ACATTTGCCATGTGCCTGATTATAGTTCTTGTTCCTCTTCTTCTTATTCTTGTGTCATAT
GGTTTCATTGCTGTGGCTGTACTCAAGATCAAGTCTGCAGCAGGAAGACAAAAAGCATTT
GGGACCTGTTCCTCCCATCTCGTTGTGGTATCCATCTTCTGTGGGACAGTTACATACATG
TATATACAGCCAGGAAACAGTCCAAATCAGAATGAGGGCAAACTTCTCAGTATATTTTAC
TCCATTGTTACTCCCAGCTTGAACCCATTAATTTATACGGTAAGGAATAAGGAGTTCAAG
GGGGCCATGAAGAGGCTAACTGGAAAAGAAAAAGATTGCATGGAA
Conceptual translation MINDSHFSGFILLGFTGQPQLQMMISGVVFFFYTIAFMGNMAIILLSFLDDHLQVPMYFF
LRNLAILDLCYTTNIVPQMLVSIWGKDKRITFGGCAFQLFIDVALYSVECILLSMMSYDR
LNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYATSLPRCRNHHLDHFFVCVK
CLQXRFKIACVDTTAMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAF
GTCSSHLVVVSIFCGTVTYMYIQPGNSPNQNEGKLLSIFYSIVTPSLNPLIYTVRNKEFK
GAMKRLTGKEKDCME

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI)
6 29,236,317 29,236,317 SNP C/T rs6910417 (DbSNP)
6 29,236,588 29,236,588 SNP A/G rs17344111 (DbSNP)
6 29,236,645 29,236,645 SNP G/T rs7766902 (DbSNP)
6 29,236,722 29,236,722 SNP A/G rs3130830 (DbSNP)
6 29,268,811 29,268,811 SNP A/G 1000GP (CEU, CHBJPT)
6 29,268,868 29,268,868 SNP G/T 1000GP (CEU, CHBJPT)
6 29,268,945 29,268,945 SNP G/A 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.