Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2W6P Olfactory Receptor

Gene Symbol OR2W6P1 (View this gene in GeneCards)
Family 2
Subfamily W
Pseudogene Yes
CORP pseudogene probability score
Aliases OR6-3, HsOR6.2.2P, ORL3146
External Ids HGNC: 15072   GeneBank: AB065475, BK004697, NG_004260   ORDB: ORL3146   
Build #39 labels OR2W6P, OR2W7P
Chromosomal location 6:27,937,403-27,938,400 (+)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2W1 64.26% 305
OR2W3 66.56% 305
OR2W4P 66.12% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2W6 91% 312
Chimp CONTIG415.105-2118 97% 333
Mouse Or2w6 95% 312
Rat Or2w6b 91% 312
Rat Or2w6 94% 312
Cow OR2W6 93% 312
Cow OR2W6CP 92% 308

Expression evidences

Source Accession
GNF Atlas2 gnf1h11116_at

Sequence information

Nucleotide sequence CTATATCTCTGCTATTCACAGGCATTCATCTTTCTCTCAACAGGTAATATGTAGCTGCAG
GTGTGGAAAACGATAATACAAGTTCTTTCGAAGGCTTCATCCTGGTGGGCTTCTCTGATC
GTCCCCACCTAGAGCTGATCGTCTTTGTGGTTGTCCTCATCTTTTATCTGCTGACTCTTC
TTGGCAACATGACCATTGTCTTGCTTTCAGCTCTGGATTCCCGGCTGCACACACCAATGT
ATTTCTTTTTGGCAAACCTCTCATTCCTGGACATGTGTTTCACCACAGGTTCCATCCCTC
AGATGCTCTACAACCTTTGGGGTCCAGATAAGACCATCAGCTATGTGGGTTGTGCCATCC
AGCTGTACTTTGTCCTGGCCCTGGGAGGGGTGGAGTGTGTCCTCCTGGCTGTCATGGCAT
ATGACCGCTATGCTGCAGTCTGCAAACCCCTGCACTACACCATCATCATGCACCCACGTC
TCTGTGGACAGCTGGCTTCAGTGGCATGGCTGAGTGGCTTTGGCAATTCTCTCATAATGG
CACCCCAGACATTGATGCTACCCCGCTGTGGGCACAGACGAGTTGACCACTTTCTCTGTG
AGATGCCAGCACTAATTGGTATGGCCTGTGTAGACACCATGATGCTTGAGGCACTGGCTT
TTGCCCTGGCAATCTTTATCATCCTGGCACCACTCATCCTCATTCTCATTTCTTATGGTT
ACGTTGGAGGAACAGTGCTTAGGATCAAGTCAGCTGCTGGGCGAAAGAAAGCCTTCAACA
CTTGCAGCTCGCATCTAATTGTTGTCTCTCTCTTCTATGGTACAATCATATACATGTACC
TCCAGCCAGCAAATACTTATTCCCAGGACCAGGGCAAGTTTCTTACCCTTTTCTACACAA
TTGTCACTCCCAGTGTTAACCCCCTGATCTATACACTAAGAAACAAAGATGTTAAAGAGG
CCATGAAGAAGGTGCTAGGGAAGGGGAGTGCAGAAATA
Conceptual translation LYLCYSQAFIFL/NRXVAAGVENDNTSSFEGFILVGFSDRPHLELIVFVVVLIFYLLT
LLGNMTIVLLSALDSRLHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCA
IQLYFVLALGGVECVLLAVMAYDRYAAVCKPLHYTIIMHPRLCGQLASVAWLSGFGNSLI
MAPQTLMLPRCGHRRVDHFLCEMPALIGMACVDTMMLEALAFALAIFIILAPLILILISY
GYVGGTVLRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFY
TIVTPSVNPLIYTLRNKDVKEAMKKVLGKGSAEI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 27,905,403 27,905,403 SNP A/G rs72848764 (DbSNP)
6 27,905,509 27,905,509 SNP C/T rs67040724 (DbSNP)
6 27,937,731 27,937,731 SNP T/C 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 69 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.