Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A15 Olfactory Receptor

Gene Symbol OR4A151 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-118, HsOR11.11.4, ORL3411
External Ids HGNC: 15152   GeneBank: AB065776, AF399578, BK004248, NM_001005275   ORDB: ORL3411   
Build #39 labels OR4A15
Chromosomal location 11:55,367,974-55,368,915 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A21P 90.58% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A15 81% 314
Chimp CONTIG1280.45-14113 97% 308
Mouse Or4a15 83% 314
Rat Or4a15 85% 301
Rat Or4a15b 82% 307
Cow OR4A15P 81% 309

Sequence information

Nucleotide sequence ATGAAAAATAAGAACAATGTGACTGAATTTATCCTCTTAGGGCTCACACAGAACCCTGAG
GGGCAAAAGGTTTTATTTGTCACATTCTTACTAATCTACATGGTGACGATAATGGGCAAC
CTGCTTATCATAGTGACCATCATGGCCAGCCAGTCCCTGGGTTCCCCCATGTACTTTTTT
CTGGCTTCTTTATCATTCATAGATACCGTCTATTCTACTGCATTTGCTCCCAAAATGATT
GTTGACTTGCTCTCTGAGAAAAAGACCATTTCCTTTCAGGGTTGTATGGCTCAACTTTTT
ATGGATCATTTATTTGCTGGTGCTGAAGTCATTCTTCTGGTGGTAATGGCCTATGATCGA
TACATGGCCATCTGTAAGCCTCTTCATGAATTGATCACCATGAATCGTCGAGTCTGTGTT
CTTATGCTGTTGGCGGCCTGGATTGGAGGCTTTCTTCACTCATTGGTTCAATTTCTCTTT
ATTTATCAGCTCCCTTTCTGTGGACCCAATGTCATTGACAACTTCCTGTGTGATTTGTAT
CCCTTATTGAAACTTGCTTGCACCAATACCTATGTCACTGGGCTTTCTATGATAGCTAAT
GGAGGAGCGATTTGTGCTGTCACCTTCTTCACTATCCTGCTTTCCTATGGGGTCATATTA
CACTCTCTTAAGACTCAGAGTTTGGAAGGGAAACGAAAAGCTTTCTACACCTGTGCATCC
CACGTCACTGTGGTCATTTTATTCTTTGTCCCCTGTATCTTCTTGTATGCAAGGCCCAAT
TCTACTTTTCCCATTGATAAATCCATGACTGTAGTTCTAACTTTTATAACTCCCATGCTG
AACCCACTAATCTATACCCTGAAGAATGCAGAAATGAAAAGTGCCATGAGGAAACTTTGG
AGTAAAAAAGTAAGCTTAGCTGGGAAATGGCTGTATCACTCA
Conceptual translation MKNKNNVTEFILLGLTQNPEGQKVLFVTFLLIYMVTIMGNLLIIVTIMASQSLGSPMYFF
LASLSFIDTVYSTAFAPKMIVDLLSEKKTISFQGCMAQLFMDHLFAGAEVILLVVMAYDR
YMAICKPLHELITMNRRVCVLMLLAAWIGGFLHSLVQFLFIYQLPFCGPNVIDNFLCDLY
PLLKLACTNTYVTGLSMIANGGAICAVTFFTILLSYGVILHSLKTQSLEGKRKAFYTCAS
HVTVVILFFVPCIFLYARPNSTFPIDKSMTVVLTFITPMLNPLIYTLKNAEMKSAMRKLW
SKKVSLAGKWLYHS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,136,345 55,136,345 NS A/T H/L rs61753616 (DbSNP)
11 55,136,279 55,136,279 NS C/T T/I rs61753622 (DbSNP)
11 55,136,219 55,136,219 NS C/T A/V rs7927370 (DbSNP)
11 55,135,689 55,135,689 SYN A/T I/I rs61916184 (DbSNP)
11 55,136,019 55,136,019 SYN C/G T/T rs61748701 (DbSNP)
11 55,368,213 55,368,213 SYN T/A I/I 1000GP (CEU)
11 55,368,400 55,368,400 SYN C/T L/L 1000GP (CEU)
11 55,368,743 55,368,743 NS C/T A/V 1000GP (CEU)
11 55,368,649 55,368,649 nonsense SNP C/T Q/* 1000GP (CHBJPT)
11 100 -100 NS C/G T/S 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,121,706 55,340,753 CopyNumber Variation_9185 (DGV)
11 55,083,434 55,156,434 CopyNumber Variation_48825 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q256* V272I A287V T304S T307I % Freq CORP
1 Q V A T T 93.39 1.000
2 Q V V T T 2.76 1.000
3 Q V A S T 2.23 1.000
4 * V A T T 1.31 1.200
5 Q V A T I 0.15 1.000
6 Q I A T T 0.15 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4A15.aApr07-unspliced main_exon 5UTR chr11 55,367,884 55,367,974 +
CDS chr11 55,367,974 55,368,915 +
3UTR chr11 55,368,915 55,368,918 +