Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A18P Olfactory Receptor

Gene Symbol OR4A18P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.9.2P, ORL3636
External Ids HGNC: 15155   GeneBank: NG_004240   ORDB: ORL3636   
Build #39 labels OR4A18P
Chromosomal location 11:49,917,490-49,918,377 (-)
Cluster 11@50
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A48P 76.23% 223

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A47EP 66% 111
Mouse Or4a47 66% 105
Rat Or4a47 66% 106
Cow OR4A47P 50% 144
Orang OR4A47P 64% 105
Horse OR4A47L 68% 105
Chimp OR4AL2P 87% 107
Chimp OR4AL1P 87% 107

Sequence information

Nucleotide sequence ATGTATTCAACAACATTGATCTCCACTTTGTCTCTGCATGTTCTCCTTTTATTTTAATTT
GTACCATTTTTTTCCCAAATAAAAGTACTTGCACTCACTTAGAGATGCTGAAATAAATTG
ATTGGTATAAAGTAAGGTATCTGATTAACCAAATTTACACTAAAGCCAATTGGCCTTTTC
ATGGATTATAACACTATGCACAACCACTCCATACTCAAACATGCATTTCTTTCTCCAATG
TTATATGATGCAGCACCTAGCTCTTTACAGGACATTTTTTTCTTGGTGGGTCACAGATTT
TCCTTCTGTTGGTGATGGCCTAGGCCACTATAGGGCCATCTGCAAGTCCTTGCAGTATTT
GGTTGTCATGAAGCAATGGCTGTGTGTTGTGCTGCTGGTGGTGTCCTGGGCTGGAGGATT
TTTGCACATAGTAATTCAACTTGGACTTATTTATGGGCTCCCATCTTATGACCCCAATGT
CATTGGTCATTTTATTTGTGACATGGACCCCTTAATGAAGCTTGTCTGTGACTACACACT
CAACAGATTTGCCTATTTTGCAGGTCATGATTAAATACTAGGTTTTATGTATTTCACTTA
TGCTCAGACTGGACTGTTTCCTTTTGGTGATTCGACCTCATTATTCTTTTGTCATTTTTT
CCCTAGAGGACTTGGTTCTATAAATCTTGCTATACATAGTTATTATCCCTGTGGCATCTC
TAGAGATACGGAGCCTACCATCAGAATTATGATAAAGGTCCCAATGAATTTAATTAGAGA
AGAATCACCTTTGGAGATGCACCAGTTGAATGACTCAACAATATGTGTTGCAGTTCAAAT
GTGGATAAAGTATCCACAGACTTCTGCCCTTACTTCAAAGAGTATTTG
Conceptual translation MYSTTLISTLSLHVLLLFXVPFFSQIKVLALTXCX\XVXKVSDXNLHXQLAF
SWIITL\QPLHTQTCISFSNVIXSTXFTGHFFLGGSQIFLLLVMA/GHYRAICKSL
QYLVVMKQWLCVVLLVVSWAGGFLHIVIQLGLIYGLPSYDPNVIGHFICDMDPLMKLVCD
YTLNRFAYFAGHDXLGFMYF\MLRLDCFLLVIRPHYSFVIFSLEDLVLXLLYIVIIP
VASLEIRSLP\NYDKGPNEFNXRITFGDAPVEXNNMCCSSNVDKVSTDFCPYFKEYL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/G 1000GP (YRI)
11 49,917,697 49,917,697 SNP A/G 1000GP (CEU)
11 49,917,832 49,917,832 SNP C/A 1000GP (CEU)
11 49,917,933 49,917,933 SNP T/G 1000GP (CEU, CHBJPT)
11 49,939,086 49,939,086 SNP C/G rs724117 (DbSNP)
11 49,939,384 49,939,384 SNP A/C rs61744827 (DbSNP)
11 49,939,485 49,939,485 SNP G/T rs11040654 (DbSNP)
11 49,939,577 49,939,577 SNP T/G rs61739435 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 49,732,291 50,117,547 CopyNumber Variation_6919 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.