Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A19P Olfactory Receptor

Gene Symbol OR4A19P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-257, HsOR11.9.3P, ORL3637
External Ids HGNC: 15156   GeneBank: BK004790, NG_004239   ORDB: ORL3637   
Build #39 labels OR4A19P
Chromosomal location 11:49,920,411-49,921,313 (-)
Cluster 11@50
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A47 90.61% 309
OR4A4P 88.35% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A47C 81% 308
Dog OR4A47F 81% 308
Chimp CONTIG2087.6-861 89% 309
Mouse Or4a47 77% 306
Rat Or4a47 77% 307
Cow OR4A104 74% 308

Sequence information

Nucleotide sequence ATGGAGCTAAGGACCAATGTGACTGACTTTGTACTCTTGTGCTTCACGCAGAATCCAAAG
GAGCAGAAAGTACTTTTTGTTATGTTCTTGCTCTTCTACATTTTGACCATGGTGGGAAAC
CTGCTAATTGTAGTCACCGTAACTGTCAGTGAGACCCTGGGCTCACCAATGTACTTCTTT
CTTGCTGGCTTATCATTTATAGATATCATTTATTCTTCATCCATTTCCCACAGATTGATT
TCAGACTTGTTCTTTGGGAATAATTCCATATCCTTCCCATCTTGCTTGGCCCAGCTCTTT
ACAGAGCACCTTTTTGGTGGGTCAGAGGTCTTTCTTCTGTTGGTGATGGCCTATGACCTT
GCATTACTTGGTTATCATGAGACAATGGGTGTGTGTTTTGCTGCTGGTAGTGTCCTGGGT
TGGAGGATTTCTGCACTCAGTATTTCAACTTAGTGTTATTTATGGGCTCCCATTCTGTGA
CCTCAATGTCATTGATCATTTTTTCTGTGATATGCACCCTTTATTGAAACTGGTCTGTAC
TGATACCCATGTTATTGGCCTCTTAGTGGTGGCCAATGGAGGACTAGGTTGCACTATTGT
GTTTCTGCTCTTACTCATCTCTTATGGTGTCATCTGCACTCTCTAAAGAACCTTAGTCAG
AAAGGGAGGTGAAAAGCCCTCTCAACCTGCAGTTCCCACATAACTGTGGTTGTTTTCTTC
TTTGTTCCCTGTATTTTTATGTATGCTAGACCTGCTAGGACCTTCCCCATTGACAAATCA
GTGAGTGTGTTTTATACAGTCATAACTCCAATGCTGAACCCTTTAATCTACACTCTGAGA
AATTCTGAGATGACAAGTGCTATGAAGAAGCTCTGGAGAAGAGACTTCATATCAAGTAGT
ACA
Conceptual translation MELRTNVTDFVLLCFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMYFF
LAGLSFIDIIYSSSISHRLISDLFFGNNSISFPSCLAQLFTEHLFGGSEVFLLLVMAYDL
\YLVIMRQWVCVLLLVVSWVGGFLHSVFQLSVIYGLPFCDLNVIDHFFCDMHPLLKLVC
TDTHVIGLLVVANGGLGCTIVFLLLLISYGVIC/SLKNLSQKGRXALSTCSSHITVVV
FFFVPCIFMYARPARTFPIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLWRRDFIS
SST

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/A 1000GP (YRI, YRI)
11 49,920,605 49,920,605 SNP C/A 1000GP (CEU, CHBJPT)
11 49,920,645 49,920,645 SNP C/T 1000GP (CEU, CHBJPT)
11 49,921,028 49,921,028 SNP A/T 1000GP (CEU, CHBJPT)
11 49,942,157 49,942,157 SNP A/C rs72918332 (DbSNP)
11 49,942,197 49,942,197 SNP C/T rs28526824 (DbSNP)
11 49,942,580 49,942,580 SNP A/T rs12364337 (DbSNP)
11 49,942,760 49,942,760 SNP G/T rs12575701 (DbSNP)
11 49,942,826 49,942,826 SNP C/A rs61753941 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 49,732,291 50,117,547 CopyNumber Variation_6919 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.