Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A40P Olfactory Receptor

Gene Symbol OR4A40P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.8.16P
External Ids HGNC: 31259   GeneBank: NG_004327   
Build #39 labels
Chromosomal location 11:48,512,320-48,513,263 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A11P 85.33% 300
OR4A13P 82.67% 300
OR4A8P 87.94% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 73% 312
Chimp CONTIG2087.8-12454 91% 315
Mouse Or4a39 76% 299
Rat Or4a74 73% 299
Cow OR4A2 68% 305

Sequence information

Nucleotide sequence ATGAGACAGAATAACAATATTACAGAAATTGTCCTCCTGGGCTTCTCCAGGATCCTGATG
TGCAAAATGCATTATTTGTCATGTTTTTACTCATATACATTGTGACTATGGTGGGGAACC
TGCTCATTGTGGTGACTATTATTGCCAGTCCCTCTTTGGGCTCCCCAATGTACTTCTTCC
TTGCCTGCCCGTCATTTATAGATGCTGTGTATTCCACCACCATTCCTCCCTTATTGATTG
TATACTTACTCTGTGATAAAAAGACTATTTCCTTCCCAGCTTGCATGGGTCAGCTATTTA
TAGACCACTTGTTAGGTGGTACTGACGTCTTCCTTCTGGTGGTGATGGCCTATGATTGCC
ACATGGCCATCTGTAAGCCACTGCACTATTTGACCATCATGAATTGACAGGTTTACATCC
TTCTGTTGGTGGTGGCTGTGACTGGAGGTTTTCTGTATTCTGTGTTTCAAATTTTAGTTG
TGTACAGTCTCCCTTTCTGTGGCCCCAATGTCATTGACCACTTTTTCTGTGACTTATACC
CTTTATTGGAACTGGGGTGCATTGACACCTACTTTATAGGCCTTGCTGTTGTTTTCAATG
GTGGAGCAATCTGTATGGTCATCTTCACCCTTCTACTAATCTCCTATGGGGTCATCCTAA
ACTCCCTTAAAACTTATAGTCAGGAAGGGAGGCATAAAGCTCTGTCTACCTGCAGCTCCC
ACATTGCCATGGTTATCTTGTTTTTTGTTCCCTGTATTTTCATATATGTTAGACCCGTTT
CAAACTTTCCTATTGATAAATTCCTGACTGTGTTTTATTCAGTTATCACACCCATGTTGA
ATCCTTTTATATACACGTTGAGAAATTCAGAGATGAGAAATGCTATAGAAAAACTCTTGT
GATACCAAAGTAGGAAGACAGGATTTAGATGCTCCAAGCTCAAT
Conceptual translation MRQNNNITEIVLLGF/QDPDVQNALFVMFLLIYIVTMVGNLLIVVTIIASPSLGSPMYF
FLACPSFIDAVYSTTIPPLLIVYLLCDKKTISFPACMGQLFIDHLLGGTDVFLLVVMAYD
CHMAICKPLHYLTIMNXVYILLLVVAVTGGFLYSVFQILVVYSLPFCGPNVIDHFFCDL
YPLLELGCIDTYFIGLAVVFNGGAICMVIFTLLLISYGVILNSLKTYSQEGRHKALSTCS
SHIAMVILFFVPCIFIYVRPVSNFPIDKFLTVFYSVITPMLNPFIYTLRNSEMRNAIEKL
LXQSRKTGFRCSKLN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/G 1000GP (YRI, YRI, YRI)
11 48,512,361 48,512,361 SNP C/T 1000GP (CEU)
11 48,512,550 48,512,550 SNP T/G 1000GP (CEU, CHBJPT)
11 48,512,775 48,512,775 SNP T/C 1000GP (CHBJPT)
11 48,513,219 48,513,219 SNP T/C 1000GP (CEU, CHBJPT)
11 48,534,102 48,534,102 SNP G/T rs4882096 (DbSNP)
11 48,534,119 48,534,119 SNP A/T rs72902632 (DbSNP)
11 48,534,160 48,534,160 SNP A/G rs73466754 (DbSNP)
11 48,534,174 48,534,174 SNP C/G rs12361373 (DbSNP)
11 48,534,327 48,534,327 SNP C/T rs10732504 (DbSNP)
11 48,534,771 48,534,771 SNP C/T rs10742851 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,479,497 48,689,328 CopyNumber Variation_5013 (DGV)
11 48,533,772 48,536,815 Deletion #208 (Waszak)
11 48,534,771 48,592,092 CopyNumber Variation_9184 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.