Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4A9P Olfactory Receptor

Gene Symbol OR4A9P1 (View this gene in GeneCards)
Family 4
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-119, HsOR11.11.5P, ORL3589
External Ids HGNC: 15166   GeneBank: BK004552, NG_004333   ORDB: ORL3589   
Build #39 labels OR4A9P
Chromosomal location 11:55,388,529-55,389,472 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4A13P 78.98% 314
OR4A45P 79.6% 299
OR4A5 81.01% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4A39 72% 306
Chimp CONTIG1280.45-34774 96% 315
Mouse Or4a39 72% 309
Rat Or4a81 69% 302
Cow OR4A2 65% 303

Sequence information

Nucleotide sequence ATGAGACCTAATAACAGCATTACAGAATTTGTCCTCCTGGGATTCTCTCAGGATCCTGGT
ATGCAAAAAGAATTATTTGTCATGTTTTTATTCACATACGTTGTGACTGTGTTGGGGAAC
CAGCTCATTGTGGTGACTATCATTGCCAGCCCTTCCTTGGGCTCCCCAATGTACTTCTTC
CTTGCCTGCCTGTCATTTATAGATGCTGCATATTTCACTGTCATTTCTCCCAAATTGATT
GTGGACTTACTCTGTGATAAAAAGACTATTTCCTTCCAAACGTTCATGGGCCAACTATTT
ATAGACCACTTCTTTGGTGGTGCAGAGGCCTTCCTTCTGGTGGTGATGGCCTATGATCGC
TATGTTGCCATCTGTAAGACATTGCACTATTTGACCATCATGACTCGACAGGTTTGTATC
CTTGCATTGCTGGTGGCTGCGACAGGCGGTTTTGTGCATTCTGTGTTTCAAATTGTTGTT
GTGTACAGTCTCCCTTTCTGTGGCGCCAATGTCATTGATCATTTCAGTTGTGACATGTAT
CCATTATTGGAACTGGCATGAACTGACACCTACTTTATAGGCCTCACTGTTGTTTTCAGT
GGTGGAGCACTCTGTATGGTCATCTTCACCCTTCTAATAATTTCCTATAGGGTCATCCTA
AACTCCCTTAAAACTTACACTCAGGAAGGGAGGCATAAAGCCCTGTCTACCTGCAGCTCC
CACATCACTGTGATTGTTCTCTTTTTATTCCCTGTATTTTCATATATGTGAGACCTGTTT
CAAACTTTTCTATTGACACATTCATGACTGTCTTTTATACAGTTATCACACCCAAGTTGA
ATCCTTTAATATACACTTTCAGAAATTCAGAGATGAGAAATGTTATAGAAAAACTCTTGG
TGAAAAAGGTAACTATATTTAGAATAACAGGGTCCATCCTCATG
Conceptual translation MRPNNSITEFVLLGFSQDPGMQKELFVMFLFTYVVTVLGNQLIVVTIIASPSLGSPMYFF
LACLSFIDAAYFTVISPKLIVDLLCDKKTISFQTFMGQLFIDHFFGGAEAFLLVVMAYDR
YVAICKTLHYLTIMTRQVCILALLVAATGGFVHSVFQIVVVYSLPFCGANVIDHFSCDMY
PLLELAXDTYFIGLTVVFSGGALCMVIFTLLIISYRVILNSLKTYTQEGRHKALSTCSS
HITVIVL/FIPCIFIYVRPVSNFSIDTFMTVFYTVITPKLNPLIYTFRNSEMRNVIEKL
LVKKVTIFRITGSILM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,154,704 55,154,704 large insertion 55945bp insertion rs72486104 (DbSNP)
11 55,091,194 55,091,194 large insertion 68235bp insertion rs72488330 (DbSNP)
11 55,106,764 55,106,764 large insertion 75252bp insertion rs72493768 (DbSNP)
11 55,156,065 55,156,065 SNP A/G rs56131310 (DbSNP)
11 55,156,173 55,156,173 SNP A/G rs61916230 (DbSNP)
11 55,156,150 55,156,150 SNP C/T rs73482054 (DbSNP)
11 55,156,941 55,156,941 SNP C/T rs61916231 (DbSNP)
11 55,156,434 55,156,434 SNP C/T rs11229374 (DbSNP)
11 55,156,444 55,156,444 SNP C/T rs11229375 (DbSNP)
11 55,156,124 55,156,124 SNP C/T rs61916229 (DbSNP)
11 55,388,589 55,388,589 SNP A/G 1000GP (CEU)
11 55,388,648 55,388,648 SNP C/T 1000GP (CEU)
11 55,388,958 55,388,958 SNP C/T 1000GP (CEU, CHBJPT)
11 55,388,968 55,388,968 SNP C/T 1000GP (CEU, CHBJPT)
11 55,389,380 55,389,380 SNP T/C 1000GP (CEU)
11 55,389,427 55,389,427 SNP G/A 1000GP (CEU)
11 55,389,465 55,389,465 SNP T/C 1000GP (CEU)
11 55,388,798 55,388,798 SNP T/C 1000GP (CHBJPT)
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,121,706 55,340,753 CopyNumber Variation_9185 (DGV)
11 55,083,434 55,156,434 CopyNumber Variation_48825 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.