Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C10P Olfactory Receptor

Gene Symbol OR4C10P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.8.11P, ORL3501
External Ids HGNC: 14800   GeneBank: AB065546, AF399444, NG_002264   ORDB: ORL3501   
Build #39 labels OR4C10P
Chromosomal location 11:48,432,220-48,433,173 (-)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C46 94.82% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C10 88% 309
Dog OR4C10C 86% 309
Chimp CONTIG2320.5-1229 97% 318
Mouse Or4c10 86% 311
Mouse Or4c10b 81% 309
Rat Or4c10b 82% 309
Rat Or4c105 81% 309
Cow OR4C10 85% 306
Cow OR4C10G 85% 309

Sequence information

Nucleotide sequence ATGCAATTAATCATCACATGAAATACATGGAGAATAGGAATAACGTGACAGAGTTTGTTT
TACTAGGGCTTACAGAGAATCCAAAGATGCAGAAAATCATATTTGTTGTGTTTTTTTGTC
ATCTATATCATCACTGTGGTGGGAAATGCGCTCATTGTGGTCACCATCACTGCCAGCCCA
TCACTGGGGTCCCCCATGTACCTTTTCCTGGCCTATCTCTCCTTTATAGATGCCTGCTAT
TCTTCTGTCAATACCCCTAAGCTGATCACAGATTCACTCTATGGAAAGAACACCATCCTA
TTCAATGGATGCATGACTCAAGTCTTTGGAGAACATTTCTTCGGAGGTGCAGAGGGTATC
CTACTTACTGTGATGGCCTATGACCGCTATGTGGCCATCTGCAAGCCCTTGCACTATATG
ACTATCATGAACCAGTGTGTGTATGCCCTGCTAATGGGAGTGGTGTGGATGGGAGGCTTT
CTTCATGCAACCATACAGATCCTCTTCATCTTCCAATTACCTTTCTGTGGTCCTAATGTC
ATAGATCACTTTATGTGTGATCTGAACCCTTTGCTCAACCTCGCCTGCACTGACACCCAT
ATGCTGGGACTCTTCATTGCTGCCAACAGTGGATTCATCTGCTTGTTAAACTTTGTCCTC
CTGCTGGTCTCCTATGTGGTCATCTTGCGCTCCCTAAGGACTCACAGCTTGGAGGCAAGG
CACAAAGCCCTCTCCACCTGTGTCTCCCACATCACAGTTGTCATCTTATTCTTTGTGCCC
TGCATATTTGTGTACATGAGACCTGCAGCTACTTTACCTATTGATAAAGCAGTTGCTATA
TTCTACACTATGATAACTCCTATGTTAAACCCCTTAATCTATACCTTGAGGAATGCCCAG
ATGAAAAATGCCATCAGGAAATTGTGTAGTAGAAAGGACATTTCAGGTAACAAA
Conceptual translation MQLIIT/KYMENRNNVTEFVLLGLTENPKMQKIIFVVFF\IYIITVVGNALIVVTITA
SPSLGSPMYLFLAYLSFIDACYSSVNTPKLITDSLYGKNTILFNGCMTQVFGEHFFGGAE
GILLTVMAYDRYVAICKPLHYMTIMNQCVYALLMGVVWMGGFLHATIQILFIFQLPFCGP
NVIDHFMCDLNPLLNLACTDTHMLGLFIAANSGFICLLNFVLLLVSYVVILRSLRTHSLE
ARHKALSTCVSHITVVILFFVPCIFVYMRPAATLPIDKAVAIFYTMITPMLNPLIYTLRN
AQMKNAIRKLCSRKDISGNK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 48,447,116 48,447,119 large insertion 9809bp insertion rs67368770 (DbSNP)
11 48,453,787 48,453,787 SNP A/G rs4882063 (DbSNP)
11 48,454,377 48,454,377 SNP C/T rs73462798 (DbSNP)
11 48,432,235 48,432,235 SNP G/A 1000GP (CEU)
11 100 -100 SNP A/C 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,447,107 48,456,924 CopyNumber Variation_5627 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
11 48,451,772 48,454,825 Deletion #203 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.