Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C15 Olfactory Receptor

Gene Symbol OR4C151 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR11-134, OR11-127, HsOR11.11.15, ORL3313
External Ids HGNC: 15171   GeneBank: AB065771, BK004319, BK004320, NM_001001920   ORDB: ORL3313   
Build #39 labels OR4C15
Chromosomal location 11:55,554,469-55,555,416 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C10P 67.66% 303
OR4C46 63.87% 310
OR4C9P 65.02% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C15 85% 311
Chimp CONTIG970.90-866 99% 316
Mouse Or4c15 83% 311
Mouse Or4c15b 80% 311
Rat Or4c15 82% 311
Cow OR4C15P 80% 311
Cow OR4C15CP 83% 280

Sequence information

Nucleotide sequence ATGCAAAACCAAAGCTTTGTAACTGAGTTTGTCCTCCTGGGACTTTCACAGAATCCAAAT
GTTCAGGAAATAGTATTTGTTGTATTTTTGTTTGTCTACATTGCAACTGTTGGGGGCAAC
ATGCTAATTGTAGTAACCATTCTCAGCAGCCCTGCTCTTCTGGTGTCTCCTATGTACTTC
TTCTTGGGCTTCCTGTCCTTCCTGGATGCGTGCTTCTCATCTGTCATCACCCCAAAGATG
ATTGTAGACTCCCTCTATGTGACAAAAACCATCTCTTTTGAAGGCTGCATGATGCAGCTC
TTTGCTGAACACTTCTTTGCTGGGGTGGAGGTGATTGTCCTCACAGCCATGGCCTATGAT
CGTTATGTGGCCATTTGCAAGCCCTTGCATTACTCTTCTATCATGAACAGGAGGCTCTGT
GGCATTCTGATGGGGGTAGCCTGGACAGGGGGCCTCTTGCATTCCATGATACAAATTCTT
TTTACTTTCCAGCTTCCCTTTTGTGGCCCCAATGTCATCAATCACTTTATGTGTGACTTG
TACCCGTTACTGGAGCTTGCCTGCACTGATACTCACATCTTTGGCCTCATGGTGGTCATC
AACAGTGGGTTTATCTGCATCATAAACTTCTCCTTGTTGCTTGTCTCCTATGCTGTCATC
TTGCTCTCTCTGAGAACACACAGTTCTGAAGGGCGCTGGAAAGCTCTCTCCACCTGTGGA
TCTCACATTGCTGTTGTGATTTTGTTCTTTGTCCCATGCATATTTGTATATACACGACCT
CCATCTGCTTTTTCCCTTGACAAAATGGCGGCAATATTTTATATCATCTTAAATCCCTTG
CTCAATCCTTTGATTTACACTTTCAGGAATAAGGAAGTAAAACAGGCCATGAGGAGAATA
TGGAACAGACTGATGGTGGTTTCTGATGAGAAAGAAAATATTAAACTT
Conceptual translation MQNQSFVTEFVLLGLSQNPNVQEIVFVVFLFVYIATVGGNMLIVVTILSSPALLVSPMYF
FLGFLSFLDACFSSVITPKMIVDSLYVTKTISFEGCMMQLFAEHFFAGVEVIVLTAMAYD
RYVAICKPLHYSSIMNRRLCGILMGVAWTGGLLHSMIQILFTFQLPFCGPNVINHFMCDL
YPLLELACTDTHIFGLMVVINSGFICIINFSLLLVSYAVILLSLRTHSSEGRWKALSTCG
SHIAVVILFFVPCIFVYTRPPSAFSLDKMAAIFYIILNPLLNPLIYTFRNKEVKQAMRRI
WNRLMVVSDEKENIKL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A V/I 1000GP (YRI, YRI)
11 100 -100 SYN A/G K/K 1000GP (YRI, YRI, YRI)
11 55,322,020 55,322,020 NS C/T L/F rs11828099 (DbSNP)
11 55,322,099 55,322,099 NS A/C D/A rs17496724 (DbSNP)
11 55,322,211 55,322,211 SYN A/G K/K rs9804659 (DbSNP)
11 55,322,298 55,322,298 SYN C/T A/A rs8181485 (DbSNP)
11 55,322,464 55,322,464 NS A/C N/H rs61919569 (DbSNP)
11 55,322,490 55,322,490 SYN A/G P/P rs61919570 (DbSNP)
11 55,322,539 55,322,539 NS A/G I/V rs12790125 (DbSNP)
11 55,322,606 55,322,606 NS C/T S/L rs17581700 (DbSNP)
11 55,322,611 55,322,635 Del(25) -/TCTCTGAGAACACACAGTTCTGAAG rs72140406 (DbSNP)
11 55,322,638 55,322,638 NS C/T R/C rs12225462 (DbSNP)
11 55,322,818 55,322,818 nonsense SNP G/T E/* rs72908448 (DbSNP)
11 55,554,623 55,554,623 NS C/A A/D 1000GP (CEU)
11 55,554,735 55,554,735 SYN A/G K/K 1000GP (CEU, CHBJPT)
11 55,554,822 55,554,822 SYN C/T A/A 1000GP (CEU, CHBJPT)
11 55,554,946 55,554,946 NS C/A L/I 1000GP (CEU)
11 55,554,988 55,554,988 NS A/C N/H 1000GP (CEU)
11 55,555,014 55,555,014 SYN G/A P/P 1000GP (CEU)
11 55,555,063 55,555,063 NS G/A V/I 1000GP (CEU, CHBJPT)
11 55,555,130 55,555,130 NS T/C L/S 1000GP (CEU)
11 55,555,162 55,555,162 NS C/T R/C 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,121,706 55,340,753 CopyNumber Variation_9185 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,276,602 55,355,722 CopyNumber Variation_9186 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F80L A106D M151L G204E L214I N228H V253I N263D L275S R286C R286H E346* % Freq CORP
1 F A M G L N V N L R R E 64.13 0.036
2 F A M G L N I N L R R E 17.67 0.036
3 F A M G L N V N L C R E 13.21 0.036
4 F D M G I H V N S R R E 2.53 0.036
5 L A M E L N V N L R R E 0.84 0.036
6 F A M G L N V N L R H E 0.46 0.036
7 L A L E L N V N L R R E 0.46 0.036
8 F D M G I H V N L R R E 0.23 0.036
9 F D M G L H V N S R R E 0.15 0.036
10 F A M G L N V N L R R * 0.15 1.200
11 F A M G L N V D L R R E 0.08 0.036
12 F A M G I N V N L R R E 0.08 0.036

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4C15.aApr07-unspliced main_exon 5UTR chr11 55,554,307 55,554,469 +
CDS chr11 55,554,469 55,555,416 +
3UTR chr11 55,555,416 55,555,419 +