Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C7P Olfactory Receptor

Gene Symbol OR4C7P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.10.7P, ORL3489
External Ids HGNC: 14768   GeneBank: NG_002229   ORDB: ORL3489   
Build #39 labels OR4C7P
Chromosomal location 11:54,635,028-54,635,995 (+)
Cluster 11@51
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C13 90.94% 309
OR4C9P 90.88% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C10 82% 309
Dog OR4C10C 80% 309
Chimp CONTIG2087.4-3954 95% 322
Mouse Or4c10 82% 303
Rat Or4c10b 79% 309
Cow OR4C10 81% 303
Cow OR4C10G 80% 311

Sequence information

Nucleotide sequence TGTTTTCTTTTCAGGTAATGCAATTAGCCACCATTTGAAATACATGGCGAATAGAAACAA
CGTGACAGAGTTTATTCTATTGGGGCTTACAGAGAATCCAAAAATGCAGAAAATCATATT
TGTTGTGTTTTGTCATCTACATCACCACCATGATAGGAAATGTGCTCATTGTGGTCACCA
TCACTGCCAGCCCATCATTGAGGTCCCCCATGTAATTTTTCCTGGCCTATCTGTCCTTTA
TTGATGCCTGCTATTCCTCTGTCAATGTCTCTAAGCTGATCACAGATTCACTCTATGAAA
ACAAGACTATCTTACTCAATGGATGTATGACTCAAGTCTTTGGAGAACATTTTTTCAGAG
GTGTTGAGGTCATCCTACTTACTGTAATGGCCTATGACTGCTATGTGGTCATCTGCAAGC
CCTTGCGCTATACCACCATCATGAAGCAGCATGTTTGTAGCCTGCTAGTGGGAGTGTCAC
GGGTGGGAGGCTTTCTTCATGCAACCATACAGATCCTCTTCATCTTCCAATTACCTTTCT
GTAGTTCTAATGTCATAGATCACTTTACGTGTGATCTCAACCCTTTGCTCAATCTTGCCT
GCACTAATACCCACACTCTAGGACTCTTCGTTGCTGCCAACAGTGGGTTCATATGCCTGT
TAAACTTTCTCTTGCTCCTGGTCTCCTATGTGGTCATACTGTACTCCTTAAGGACCCACA
GCTTAGAGGCAAGGCACAAAGGCCTCTCCACCTGTGTCTCCCACAACACAGTTGTCATCT
TATTCTTTATACCCTGCATATTTGTGTACATGAGACCTCCAGCTACTTTACCCATTGATA
AAGCAGTTGCTGTATTCTACACTATGATAACTCCTATGTTAAACCCCTTAATCTACACCT
TGAGGAATGCTCAGATGAAAAATGCCATTAGGAAATTGTGTAGTAGGAAAGCTATTTCAA
GTGTCAAA
Conceptual translation CFLFRXN\HHLKYMANRNNVTEFILLGLTENPKMQKIIFVVF\IYITTMIGNVLIVV
TITASPSLRSPMXFLAYLSFIDACYSSVNVSKLITDSLYENKTILLNGCMTQVFGEHFF
RGVEVILLTVMAYDCYVVICKPLRYTTIMKQHVCSLLVGVSRVGGFLHATIQILFIFQLP
FCSSNVIDHFTCDLNPLLNLACTNTHTLGLFVAANSGFICLLNFLLLLVSYVVILYSLRT
HSLEARHKGLSTCVSHNTVVILFFIPCIFVYMRPPATLPIDKAVAVFYTMITPMLNPLIY
TLRNAQMKNAIRKLCSRKAISSVK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI)
11 51,483,304 51,483,304 SNP C/T rs7482674 (DbSNP)
11 51,483,331 51,483,331 SNP C/T rs72482368 (DbSNP)
11 51,483,353 51,483,353 SNP A/G rs72908563 (DbSNP)
11 51,483,388 51,483,388 SNP C/T rs61892965 (DbSNP)
11 51,483,423 51,483,423 SNP A/C/T rs4614433 (DbSNP)
11 51,483,852 51,483,852 Del(1) -/G rs34676785 (DbSNP)
11 51,484,198 51,484,198 SNP A/G rs11820009 (DbSNP)
11 54,635,722 54,635,722 SNP A/T 1000GP (CEU)
11 54,635,975 54,635,975 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 51,192,824 51,563,636 CopyNumber Variation_8689 (DGV)
11 51,228,146 51,525,878 CopyNumber Variation_48823 (DGV)
11 51,372,036 51,529,002 CopyNumber Variation_53111 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.