Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4C9P Olfactory Receptor

Gene Symbol OR4C9P1 (View this gene in GeneCards)
Family 4
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.8.12P, ORL3498
External Ids HGNC: 14796   GeneBank: AB065548, NG_002267   ORDB: ORL3498   
Build #39 labels OR4C9P
Chromosomal location 11:48,464,065-48,465,020 (-)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C13 90.16% 305
OR4C7P 90.88% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C10 84% 302
Dog OR4C10C 82% 302
Chimp CONTIG2087.4-3954 90% 318
Chimp CONTIG7566.1-618 90% 305
Chimp CONTIG2320.5-1229 85% 305
Mouse Or4c10 83% 300
Mouse Or4c10b 81% 303
Rat Or4c10b 81% 303
Cow OR4C10 82% 304
Cow OR4C10G 84% 303

Sequence information

Nucleotide sequence TGTTTTCTTTTCAGGTATTGTAATTAACCACCATTTGAAATACATGGTGAATAGAAACAA
TGTGACAGAGTTTATTCTACTGGGGCTTATAGAGAATCCAAAAATGCAGAAAATCATATT
TGTTGTGTTTTGTCATCTACATCACCACCATGATAGGAAATGTGCTCATTGTGGTCACCG
TCACTGCCAGCCCATCATTGAGGTCCCCCATGTACTTTTACCTGGCCTATCTGTCCTTTA
TTGATGCCTGCTATTCCTCCGTCAATGCCCCTAAGCTGATCACAGATTCACTCTATGAAA
ACAAGACTATCTTACTCAATGGATGTATGACTCAAGTCTTTGGAGAACATTTTTTCGGAG
GTGTTGAGGTCATCCTACTTACTGTAATGGCCTATGACCGCTACGTGGTCATCTGCAAGC
CCTTGCACTATACCACCATCATGAAGCAGCATGTTTGTAGCCTGCTAGTGGGAGTGTCAT
GGGTAGGAGGCTTTCTTCATGCAACCGTACAGATCCTCTTCATCTTCCAATTACCTTTCT
GTGGTCCTAATGTCATAGATCACTTTATGTGGGATCTCAACCCTTTGCTCAATCTTGTCT
GCACTAATACCCACACTCTAGGACTCTTCGTTGCTGCCAACAGTGGGTTCATATGCCTGT
TAAACTTTCTCTTGCTCCTGGTCTCCTATATGGTCATACTGTACTCCTTAAGGACCCACA
GCTTAGAGGCAAGGTGCAAAGCCCTCTCCACCTGTGTCTCCCACATCACAGTTGTCATCT
TATTCTTTATACCCTGCATATTTGTGTACATGAGACCTCCAGCTACTTTACCCATTGATA
AAGCAGTTGCTGTATTCTACACTATGATAGCTCCTATGTTAAACCCCTTAATCTACACCT
TGAGGAATGCTCAGATGAAAAATGCCATTAGGAAATTGTGTAGTAGGAAAGCTATT
Conceptual translation CFLFRYCNXPFEI\VNRNNVTEFILLGLIENPKMQKIIFVVF\IYITTMIGNVLIVV
TVTASPSLRSPMYFYLAYLSFIDACYSSVNAPKLITDSLYENKTILLNGCMTQVFGEHFF
GGVEVILLTVMAYDRYVVICKPLHYTTIMKQHVCSLLVGVSWVGGFLHATVQILFIFQLP
FCGPNVIDHFMWDLNPLLNLVCTNTHTLGLFVAANSGFICLLNFLLLLVSYMVILYSLRT
HSLEARCKALSTCVSHITVVILFFIPCIFVYMRPPATLPIDKAVAVFYTMIAPMLNPLIY
TLRNAQMKNAIRKLCSRKAI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI)
11 48,464,325 48,464,325 SNP T/C 1000GP (CEU, CHBJPT)
11 48,485,877 48,485,877 SNP C/T rs9667626 (DbSNP)
11 48,486,525 48,486,525 SNP A/C/G rs4882074 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 132 (Hasin)
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,346,202 48,972,502 CopyNumber Variation_9183 (DGV)
11 48,365,757 49,068,634 CopyNumber Variation_2922 (DGV)
11 48,479,497 48,689,328 CopyNumber Variation_5013 (DGV)
11 48,483,617 48,486,672 Deletion #204 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.