Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D11 Olfactory Receptor

Gene Symbol OR4D111 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.8 (pseudogene)
Aliases OR11-252, HsOR11.13.10
External Ids HGNC: 15174   GeneBank: AB065810, AF399440, BK004688, NM_001004706   
Build #39 labels OR4D11P
Chromosomal location 11:59,503,576-59,504,508 (+)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D10 81.35% 311
OR4D8P 80.46% 302
OR4D9 82.26% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D11 91% 307
Chimp CONTIG466.5-15588 97% 311
Mouse Or4d11 88% 310
Rat Or4d11 87% 310
Rat Or4d10c 82% 309
Rat Or4d10 81% 308
Cow OR4D11 83% 308
Cow OR4D9D 81% 311
Cow OR4D9 81% 310
Cow OR4D11B 81% 311
Cow OR4D31 81% 309

Sequence information

Nucleotide sequence ATGGAGTTGGGAAATGTCACCAGAGTAAAAGAATTTATATTTCTGGGACTTACTCAATCC
CAAGACCAGAGTTTGGTCTTGTTTCTTTTTTTATGTCTTGTGTACATGACGACTCTGCTG
GGAAACCTCCTCATCATGGTCACCGTGACCTGTGAGTCTCGCCTTCACACCCCCATGTAC
TTCCTGCTCCGCAATCTAGCCATCCTTGACATCTGCTTCTCCTCCACAACTGCTCCTAAA
GTCTTGCTGGACCTTCTGTCAAAGAAAAAGACCATATCCTATACAAGCTGCATGACACAG
ATATTTCTCTTCCACCTCCTTGGTGGGGCAGACATTTTTTCTCTCTCTGTGATGGCGTTT
GACTGCTACATGGCCATCTCCAAGCCCCTGCACTATGTGACCATCATGAGTAGAGGGCAA
TGCACTGCCCTCATCTCTGCCTCTTGGATGGGGGGCTTTGTCCACTCCATCGTGCAGATC
TCCCTGTTGCTGCCTCTCCCTTTCTGTGGACCCAATGTTCTTGACACTTTCTACTGCGAT
GTCCCCCAGGTCCTCAAACTCACTTGCACTGACACTTTTGCTCTTGAGTTCTTGATGATT
TCCAACAATGGCCTGGTCACTACCCTGTGGTTTATCTTCCTGCTTGTGTCCTACACAGTC
ATCCTAATGACGCTGAGGTCTCAGGCAGGAGGGGGCAGGAGGAAAGCCATCTCCACTTGC
ACCTCCCACATCACTGTGGTGACCCTGCATTTTGTGCCCTGCATCTATGTCTATGCCCGG
CCCTTCACTGCCCTCCCCACAGAAAAGGCCATCTCTGTCACCTTCACTGTCATCTCCCCT
CTGCTGAACCCTTTGATCTACACTCTGAGGAACCAGGAAATGAAGTCAGCCATGAGAAGA
CTGAAGAGAAGACTCGTGCCTTCTGAAAGGGAA
Conceptual translation MELGNVTRVKEFIFLGLTQSQDQSLVLFLFLCLVYMTTLLGNLLIMVTVTCESRLHTPMY
FLLRNLAILDICFSSTTAPKVLLDLLSKKKTISYTSCMTQIFLFHLLGGADIFSLSVMAF
DCYMAISKPLHYVTIMSRGQCTALISASWMGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VPQVLKLTCTDTFALEFLMISNNGLVTTLWFIFLLVSYTVILMTLRSQAGGGRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPTEKAISVTFTVISPLLNPLIYTLRNQEMKSAMRR
LKRRLVPSERE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,271,637 59,271,637 NS C/T L/F rs7120079 (DbSNP)
11 59,271,882 59,271,882 SYN C/T I/I rs11823447 (DbSNP)
11 59,504,164 59,504,164 NS T/C F/L 1000GP (CEU, CHBJPT)
11 59,503,696 59,503,696 NS G/A G/R 1000GP (CEU)
11 59,503,675 59,503,675 NS G/T V/L 1000GP (CHBJPT)
11 100 -100 NS C/G A/G 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 59,270,949 59,273,981 CopyNumber #80 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A143G F197L % Freq CORP
1 A F 66.44 0.877
2 A L 31.72 0.877
3 G F 1.84 0.877

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4D11.aApr07-unspliced main_exon CDS chr11 59,503,576 59,504,508 +
3UTR chr11 59,504,508 59,504,511 +