Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D5 Olfactory Receptor

Gene Symbol OR4D51 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.16 (functional)
Aliases OR11-276, HsOR11.18.6, ORL3292
External Ids HGNC: 14852   GeneBank: AB065760, BK004316, NM_001001965   ORDB: ORL3292   
Build #39 labels OR4D5
Chromosomal location 11:123,939,617-123,940,570 (+)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D1 61.79% 301
OR4D6 59.68% 315
OR4D9 62.5% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D5 89% 314
Chimp CONTIG708.114-14757 99% 318
Mouse Or4d5 90% 314
Rat Or4d5 90% 314
Cow OR4D5 88% 314

Expression evidences

Source Accession
mRNA BC136945
GNF Atlas2 gnf1h05563_s_at

Sequence information

Nucleotide sequence ATGAATCCAGCAAATCATTCCCAGGTGGCAGGATTTGTTCTACTGGGGCTCTCTCAGGTT
TGGGAGCTTCGGTTTGTTTTCTTCACTGTTTTCTCTGCTGTGTATTTTATGACTGTAGTG
GGAAACCTTCTTATTGTGGTCATAGTGACCTCCGACCCACACCTGCACACAACCATGTAT
TTTCTCTTGGGCAATCTTTCTTTCCTGGACTTTTGCTACTCTTCCATCACAGCACCTAGG
ATGCTGGTTGACTTGCTCTCAGGCAACCCTACCATTTCCTTTGGTGGATGCCTGACTCAA
CTCTTCTTCTTCCACTTCATTGGAGGCATCAAGATCTTCCTGCTGACTGTCATGGCGTAT
GACCGCTACATTGCCATTTCCCAGCCCCTGCACTACACGCTCATTATGAATCAGACTGTC
TGTGCACTCCTTATGGCAGCCTCCTGGGTGGGGGGCTTCATCCACTCCATAGTACAGATT
GCATTGACTATCCAGCTGCCATTCTGTGGGCCTGACAAGCTGGACAACTTTTATTGTGAT
GTGCCTCAGCTGATCAAATTGGCCTGCACAGATACCTTTGTCTTAGAGCTTTTAATGGTG
TCTAACAATGGCCTGGTGACCCTGATGTGTTTTCTGGTGCTTCTGGGATCGTACACAGCA
CTGCTAGTCATGCTCCGAAGCCACTCACGGGAGGGCCGCAGCAAGGCCCTGTCTACCTGT
GCCTCTCACATTGCTGTGGTGACCTTAATCTTTGTGCCTTGCATCTACGTCTATACAAGG
CCTTTTCGGACATTCCCCATGGACAAGGCCGTCTCTGTGCTATACACAATTGTCACCCCC
ATGCTGAATCCTGCCATCTATACCCTGAGAAACAAGGAAGTGATCATGGCCATGAAGAAG
CTGTGGAGGAGGAAAAAGGACCCTATTGGTCCCCTGGAGCACAGACCCTTACAT
Conceptual translation MNPANHSQVAGFVLLGLSQVWELRFVFFTVFSAVYFMTVVGNLLIVVIVTSDPHLHTTMY
FLLGNLSFLDFCYSSITAPRMLVDLLSGNPTISFGGCLTQLFFFHFIGGIKIFLLTVMAY
DRYIAISQPLHYTLIMNQTVCALLMAASWVGGFIHSIVQIALTIQLPFCGPDKLDNFYCD
VPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTALLVMLRSHSREGRSKALSTC
ASHIAVVTLIFVPCIYVYTRPFRTFPMDKAVSVLYTIVTPMLNPAIYTLRNKEVIMAMKK
LWRRKKDPIGPLEHRPLH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/T C/F 1000GP (YRI, YRI)
11 100 -100 SYN G/T L/L 1000GP (YRI, YRI)
11 123,811,013 123,811,013 SYN A/G R/R rs17127996 (DbSNP)
11 123,939,785 123,939,785 NS A/C T/P 1000GP (CEU)
11 123,940,306 123,940,306 SYN G/A R/R 1000GP (CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T57P C141F D175V R233C % Freq CORP
1 T C D R 96.54 0.323
2 T C D C 1.46 0.282
3 P C D R 0.84 0.323
4 T C V R 0.69 0.323
5 T F D R 0.46 0.323

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4D5.aApr07-unspliced main_exon CDS chr11 123,939,617 123,940,570 +
3UTR chr11 123,940,570 123,940,573 +