Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D9 Olfactory Receptor

Gene Symbol OR4D91 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.2 (functional)
Aliases OR11-253, HsOR11.13.11, ORL3412
External Ids HGNC: 15178   GeneBank: AB065861, BK004309, NM_001004711   ORDB: ORL3412   
Build #39 labels OR4D9
Chromosomal location 11:59,514,913-59,515,854 (+)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D10 79.35% 310
OR4D11 82.26% 310
OR4D8P 77.81% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D9 89% 311
Dog OR4D9C 83% 310
Chimp CONTIG466.5-25182 98% 314
Mouse Or4d11 81% 310
Mouse Or4d10c 83% 307
Mouse Or4d10 82% 305
Rat Or4d11 81% 310
Rat Or4d10c 83% 307
Rat Or4d10 82% 308
Cow OR4D9 87% 311
Cow OR4D11 80% 308

Expression evidences

Source Accession
GNF Atlas2 gnf1h02110_at

Sequence information

Nucleotide sequence ATGGATCAGAGAAATTACACCAGAGTGAAAGAATTTACCTTCCTGGGAATTACTCAGTCC
CGAGAACTGAGCCAGGTCTTATTTACCTTCCTGTTTTTGGTGTACATGACAACTCTAATG
GGAAACTTCCTCATCATGGTTACAGTTACCTGTGAATCTCACCTTCATACGCCCATGTAC
TTCCTGCTCCGCAACCTGTCTATTCTTGACATCTGCTTTTCCTCCATCACAGCTCCTAAG
GTCCTGATAGATCTTCTATCAGAGACAAAAACCATCTCCTTCAGTGGCTGTGTCACTCAA
ATGTTCTTCTTCCACCTTCTGGGGGGAGCAGACGTTTTTTCTCTCTCTGTGATGGCGTTT
GACCGCTATATAGCCATCTCCAAGCCCCTGCACTATATGACCATCATGAGTAGGGGGCGA
TGCACAGGCCTCATCGTGGCTTCCTGGGTGGGGGGCTTTGTCCACTCCATAGCGCAGATT
TCTCTATTGCTCCCACTCCCTTTCTGTGGACCCAATGTTCTTGACACTTTCTACTGCGAT
GTCCCCCAGGTCCTCAAACTTGCCTGCACTGACACCTTCACTCTGGAGCTCCTGATGATT
TCAAATAATGGGTTAGTCAGTTGGTTTGTATTCTTCTTTCTCCTCATATCTTACACGGTC
ATCTTGATGATGCTGAGGTCTCACACTGGGGAAGGCAGGAGGAAAGCCATCTCCACCTGC
ACCTCCCACATCACCGTGGTGACCCTGCATTTCGTGCCCTGCATCTATGTCTATGCCCGG
CCCTTCACTGCCCTCCCCACAGACACTGCCATCTCTGTCACCTTCACTGTCATCTCCCCT
TTGCTCAATCCTATAATTTACACGCTGAGGAATCAGGAAATGAAGTTGGCCATGAGGAAA
CTGAAGAGACGGCTAGGACAATCAGAAAGGATTTTAATTCAA
Conceptual translation MDQRNYTRVKEFTFLGITQSRELSQVLFTFLFLVYMTTLMGNFLIMVTVTCESHLHTPMY
FLLRNLSILDICFSSITAPKVLIDLLSETKTISFSGCVTQMFFFHLLGGADVFSLSVMAF
DRYIAISKPLHYMTIMSRGRCTGLIVASWVGGFVHSIAQISLLLPLPFCGPNVLDTFYCD
VPQVLKLACTDTFTLELLMISNNGLVSWFVFFFLLISYTVILMMLRSHTGEGRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPTDTAISVTFTVISPLLNPIIYTLRNQEMKLAMRK
LKRRLGQSERILIQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,282,861 59,282,861 NS A/G Q/R rs17501584 (DbSNP)
11 59,283,310 59,283,310 NS C/G Q/E rs12794170 (DbSNP)
11 59,283,309 59,283,309 SYN A/G S/S rs12796451 (DbSNP)
11 59,515,388 59,515,388 NS A/G Q/R 1000GP (CEU)
11 100 -100 SYN G/A K/K 1000GP (YRI, YRI, YRI)
11 100 -100 NS C/T T/I 1000GP (YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R64C S75A T89I Q159R T192S T219M C254S R304W L305P % Freq CORP
1 R S T Q T T C R L 93.09 0.285
2 R S I Q S T C R P 2.84 0.285
3 R S T R T T C R L 1.69 0.285
4 R A T Q T T C R L 0.84 0.285
5 R S T Q T M C R L 0.69 0.285
6 R S T Q T T S R L 0.38 0.285
7 C S T Q T T C R L 0.23 0.285
8 R S T Q T T C W L 0.15 0.285
9 R S T Q S M C R P 0.08 0.285

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4D9.aApr07-unspliced main_exon CDS chr11 59,514,913 59,515,854 +
3UTR chr11 59,515,854 59,515,857 +