Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F21 Olfactory Receptor

Gene Symbol OR4F211 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.58 (pseudogene)
Aliases HsOR8.1.1
External Ids HGNC: 19583   GeneBank: NM_001005504   
Build #39 labels OR4F21P
Chromosomal location 8:166,089-167,024 (-)
Cluster 8@0
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F16 99.04% 312
OR4F29 99.04% 312
OR4F3 99.04% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 91% 312
Chimp CONTIG5079.3-2008 98% 312
Chimp CONTIG4060.3-4296 97% 312
Chimp CONTIG9284.2-1002 96% 312
Mouse Or4f7 81% 312
Rat Or4f7 82% 312
Rat Or4f7b 82% 312
Rat Or4f7c 82% 312
Cow OR4F1 90% 312
Cow OR4F1D 88% 312
Cow OR4F1C 88% 309

Expression evidences

Source Accession
GNF Atlas2 221539_at

Sequence information

Nucleotide sequence ATGGATGGAGAGAATCACTCAGTGGTATCTGAGTTTTTGTTTCTGGGACTCACTCATTCA
TGGGAGATCCAGCTCCTCCTCCTAGTGTTTTCCTCTGTGCTCTATGTGGCAAGCATTACT
GGAAACATCTTCATTGTGTTTTCTGTGACCACTGACCCTCACTTACACTCCCCCATGTAC
TTTCTACTGGCCAGTCTCTCCTTCATTGACTTAGGAGCCTGCTCTGTCACTTCTCCCAAG
ATGATTTATGACCTGTTCAGAAAGCGCAAAGTCATCTCCTTTGGAGGCTGCATCGCTCAA
ATCTTCTTCATCCACGTCATTGGTGGTGTGGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGATATGTGGCCCTATGTAAGCCCCTCCACTATCTGACCATTATGAGCCCAAGAATG
TGCCTTTCATTTCTGGCTGTTGCCTGGACCCTTGGTGTCAGTCACTCCCTGTTCCAACTG
GCATTTCTTGTTAATTTAGCCTTCTGTGGCCCTAATGTGTTGGACAGCTTCTACTGTGAC
CTTCCTCGGCTTCTCAGACTAGCCTGTACCGACACCTACAGATTGCAGTTCATGGTCACT
GTTAACAGTGGGTTTATCTGTGTGGGTACTTTCTTCATACTTCTAATCTCCTACGTCTTC
ATCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGTTCATCCAAGGCCCTTTCCACTCTT
TCAGCTCACAGCACAGTGGTCCTTTTGTTCTTTGGTCCACCCATGTTTGTGTATACACGG
CCACACCCTAATTCACAGATGGACAAGTTTCTGGCTATTTTTGATGCAGTTCTCACTCCT
TTTCTGAATCCAGTTGTCTATACATTCAGGAATAAGGAGATGAAGGCAGCAATAAAGAGA
GTATGCAAACAGCTAGTGATTTACAAGAAGATCTCA
Conceptual translation MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNIFIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF
DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD
LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL
SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR
VCKQLVIYKKIS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
8 17,005 131,941 CopyNumber Variation_70154 (DGV)
8 22,850 128,483 CopyNumber Variation_32973 (DGV)
8 35,462 153,512 CopyNumber Variation_95092 (DGV)
8 40,472 198,712 CopyNumber Variation_4575 (DGV)
8 69,932 520,115 CopyNumber Variation_3716 (DGV)
8 76,830 155,180 CopyNumber Variation_70151 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F21.aApr07-unspliced main_exon 3UTR chr8 166,086 166,089 -
CDS chr8 166,089 167,024 -
5UTR chr8 167,024 167,823 -