Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F29 Olfactory Receptor

Gene Symbol OR4F291 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.58 (pseudogene)
Aliases OR1-1, OR7-21, HsOR5.4.5
External Ids HGNC: 31275   GeneBank: BK004219, BK004481, NM_001005221, NM_001005224, NM_001005277   
Build #39 labels
Chromosomal location 1:450,742-451,677 (+)
Cluster 1@0b
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F16 100% 312
OR4F21 99.04% 312
OR4F3 100% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 91% 312
Chimp CONTIG5079.3-2008 97% 312
Chimp CONTIG4060.3-4296 97% 312
Chimp CONTIG9284.2-1002 96% 312
Mouse Or4f7 82% 312
Rat Or4f7 83% 312
Rat Or4f7b 83% 312
Rat Or4f7c 82% 312
Cow OR4F1 90% 312
Cow OR4F1D 87% 312
Cow OR4F1C 88% 309

Expression evidences

Source Accession
mRNA BC137568
GNF Atlas2 218647_s_at

Sequence information

Nucleotide sequence ATGGATGGAGAGAATCACTCAGTGGTATCTGAGTTTTTGTTTCTGGGACTCACTCATTCA
TGGGAGATCCAGCTCCTCCTCCTAGTGTTTTCCTCTGTGCTCTATGTGGCAAGCATTACT
GGAAACATCCTCATTGTGTTTTCTGTGACCACTGACCCTCACTTACACTCCCCCATGTAC
TTTCTACTGGCCAGTCTCTCCTTCATTGACTTAGGAGCCTGCTCTGTCACTTCTCCCAAG
ATGATTTATGACCTGTTCAGAAAGCGCAAAGTCATCTCCTTTGGAGGCTGCATCGCTCAA
ATCTTCTTCATCCACGTCGTTGGTGGTGTGGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGATATGTGGCCCTATGTAAGCCCCTCCACTATCTGACCATTATGAGCCCAAGAATG
TGCCTTTCATTTCTGGCTGTTGCCTGGACCCTTGGTGTCAGTCACTCCCTGTTCCAACTG
GCATTTCTTGTTAATTTAGCCTTCTGTGGCCCTAATGTGTTGGACAGCTTCTACTGTGAC
CTTCCTCGGCTTCTCAGACTAGCCTGTACCGACACCTACAGATTGCAGTTCATGGTCACT
GTTAACAGTGGGTTTATCTGTGTGGGTACTTTCTTCATACTTCTAATCTCCTACGTCTTC
ATCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGTTCATCCAAGGCCCTTTCCACTCTT
TCAGCTCACAGCACAGTGGTCCTTTTGTTCTTTGGTCCACCCATGTTTGTGTATACACGG
CCACACCCTAATTCACAGATGGACAAGTTTCTGGCTATTTTTGATGCAGTTCTCACTCCT
TTTCTGAATCCAGTTGTCTATACATTCAGGAATAAGGAGATGAAGGCAGCAATAAAGAGA
GTATGCAAACAGCTAGTGATTTACAAGAGGATCTCA
Conceptual translation MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAF
DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD
LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL
SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR
VCKQLVIYKRIS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber 197 (Hasin)
1 10,377 998,287 CopyNumber Variation_3274 (DGV)
1 87,959 1,018,704 CopyNumber Variation_2294 (DGV)
1 317,770 471,337 CopyNumber Variation_68764 (DGV)
1 317,874 425,175 CopyNumber Variation_4189 (DGV)
1 321,799 438,545 CopyNumber Variation_37590 (DGV)
1 321,799 466,601 CopyNumber Variation_37559 (DGV), Variation_37598 (DGV)
1 350,531 404,112 CopyNumber Variation_68762 (DGV)
1 356,214 633,476 CopyNumber Variation_31594 (DGV)
1 356,623 688,990 CopyNumber Variation_74278 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F29.aApr07-unspliced main_exon 3UTR chr1 450,739 450,742 +
CDS chr1 450,742 451,677 +
5UTR chr1 451,677 452,476 +