Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4G1P Olfactory Receptor

Gene Symbol OR4G1P1 (View this gene in GeneCards)
Family 4
Subfamily G
Pseudogene Yes
CORP pseudogene probability score
Aliases OLB, HsOR19.1.2P, ORL3744
External Ids HGNC: 8302   GeneBank: NG_004133   ORDB: ORL3744   
Build #39 labels OR4G1P
Chromosomal location 19:104,601-105,469 (+)
Cluster 19@0
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4G11P 97.93% 290
OR4G2P 98.97% 290

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4G11 82% 288
Mouse Or4g7 79% 287
Rat Or4g7 80% 289
Cow OR4G2 83% 290
Orang OR4G2P 91% 278
Horse OR4G2 83% 290
Chimp OR4G2 98% 290

Expression evidences

Source Accession
ESTs BI035310

Sequence information

Nucleotide sequence ATGCAGTTTTTCCTTTTTCTCTTCTTCTCTTTATTCTATGTGGGAATTATCCTGGGAAAC
CTCTTCATTGTGTTCACAGTGATCTTTGATCCTCACTTACACTCCCCCATGTATATTCTG
CTGGCCAACCTATCGCTCATTGACTTGAGCCTTTCATCTACCACAGTTCCTAGGTTGATC
TACGATCTTTTTACTGATTGTAAAGTTATTTCCTTCCATAATTGTATGATACAAAAGTTC
TTTATCCATGTTACGGGAGGAGTTGAAATGGTGCTGCTGATAGTCATGGAATATGATAGG
TACACTGCGATCTGCAAGCCTCTCCACTATCCAACTATTATGAATCCCAAAATGTGCATG
TTTTTGGTAGCAGCAGCTTGGGTCATTGGGGTGATTCATGCTATGTCTCAGTTTGTTTTT
GTCATAAATTAACCTTCTGTGGCCCTAATAATGTGGGGAGCTTTTATTGTGATTTTCCTC
GGGTTATTAAACTTGCATGCATGGACACTTACGGGCTAGAATTTGTGGTCACTGCCAACA
GTGGATTCATATCGATGGGCACCTTCTTTTTCTTAATTGTATCATACATTTTTATTCTGG
TCACTGTCCAACGACATTCCTCAAATGATTTATCCAAAGCATTCTTCACTTCGTAGGCTC
ACATCACCGTAGTGGTTTTGTTTTTTGCTCCATGCATGTTTCTCTACGTGTGGCCTTTCC
CTACTAAGTCATTGGATAAATTTTTTGCCATCATGAACTTTGTTGTCACCCCTGTCTTAA
ATCCTGCCATCTATACTTTAAGGAACAAAGATATGAAGTTTGCAATGAGAAGGCTGAATC
AACATATTTTAAATTCTATGGAGACGACA
Conceptual translation MQFFLFLFFSLFYVGIILGNLFIVFTVIFDPHLHSPMYILLANLSLIDLSLSSTTVPRLI
YDLFTDCKVISFHNCMIQKFFIHVTGGVEMVLLIVMEYDRYTAICKPLHYPTIMNPKMCM
FLVAAAWVIGVIHAMSQFVFVINXPFCGPNNVGSFYCDFPRVIKLACMDTYGLEFVVTA
NSGFISMGTFFFLIVSYIFILVTVQRHSSNDLSKAFFTSXHITVVVLFFAPCMFLYVWP
FPTKSLDKFFAIMNFVVTPVLNPAIYTLRNKDMKFAMRRLNQHILNSMETT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 105,021 105,021 SNP C/G rs7260412 (DbSNP)
19 104,854 104,854 SNP C/T rs2346358 (DbSNP)
19 104,945 104,945 SNP T/C rs72481017 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 60,354 168,972 CopyNumber Variation_30879 (DGV)
19 60,070 172,370 CopyNumber Variation_73240 (DGV)
19 60,070 243,098 CopyNumber Variation_73242 (DGV)
19 60,179 119,175 CopyNumber Variation_78021 (DGV), Variation_89026 (DGV)
19 89,677 123,389 CopyNumber Variation_78022 (DGV)
19 89,677 165,529 CopyNumber Variation_78024 (DGV)
19 89,677 119,175 CopyNumber Variation_89027 (DGV)
CopyNumber 25 (Hasin)
19 104,677 104,829 Del(-10) #28(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.