Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4G3P Olfactory Receptor

Gene Symbol OR4G3P1 (View this gene in GeneCards)
Family 4
Subfamily G
Pseudogene Yes
CORP pseudogene probability score
Aliases OLC-7501, HsOR19.1.1P, ORL3795
External Ids HGNC: 8304   GeneBank: NG_003222   ORDB: ORL3795   
Build #39 labels OR4G5P, OR4G3P
Chromosomal location 19:94,062-95,005 (+)
Cluster 19@0
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4G4P 99.68% 314
OR4G6P 99.36% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4G9 71% 309
Mouse Or4g7 57% 312
Rat Or4g7 57% 314
Cow OR4G9 70% 314
Orang OR4G3BP 91% 294
Horse OR4G25 68% 314
Chimp OR4G2 62% 310

Expression evidences

Source Accession
ESTs BG206860

Sequence information

Nucleotide sequence ATGGATAGAGTAAATAATTCTGCGGTATCTAAATTTGTATTGATTGGACTTTCAAGCTCT
TGGGAGATGCATCTTTTTCTTTTTTGGTTCTTCTCTGTGTTCTACATGGGAATTATCCTG
GAAAATCTCTTCATTGTGTTCACAGTAATTATTGACTCTCATTTAAATTCCCCAGGTACT
GCCTACTGGCCAACATTTATCTTCTTGATCTGGGTCTTCTCCTACAGTTCTGACTTTTTC
ACTAACTGCAGCATCATTTCTTTTCCAAGATGCATGATACAGATATTTTTCATTTGTGTC
ATGCGTAAAAATTGAGATGGTGCTGCTCATAACCATGGCATAGAGCAGGTACACTGCCAA
TCTGTAAGCCTCCCCATTACCTGACCACAATGAACCCCAAAATGTGTGTTTCCTTTGTTG
GAGGCATCCTGGATAGTCAGGATAATCCATGCTGTATCTCAGTTTGTTTTTGCCATAAAC
TTGCCTTTTTGTGGCCCTAATAGAGTAGGTAGTTTTCACTGTGATTTTCCTTATGTCATG
AAACTTGCTTGTGTAGATACTTACAAACTAGAGGTTGTAGTCACTGCTAACAGTGGGCTT
ATATCCATAGCTACCTGTTTCTTATTAATAATATCCTATATTTTCATTTCGGTAACCGTC
TAGAATCCTTCTTCAGGAGACTTATCTAAAGCATTTGTGTCATGTTAGATCACATCACAG
TAGGGATTTTGTTTTTTATGCCATGTATATTTCTCTATGTGTAGCCTTTGCCTAAAACAA
CACATGATTAATATTTGTTCATTGTTCCTTTTGCTATCACCCCTGTCTAGGATCTACACA
TTAAGAAACAAAGACATGAACGTCTCCATGGAAAGACTGGGAAAATGGATTGCAGGTTCT
AGCAGGATGTCATAATAAATGGTGCATATCCAGAGTGCAAGATG
Conceptual translation MDRVNNSAVSKFVLIGLSSSWEMHLFLFWFFSVFYMGIILENLFIVFTVIIDSHLNSP/
YCLLANIYLLDL\FSYSSDFFTNCSIISFPRCMIQIFFICVMRK\EMVLLITMAXRY
TA\CKPPHYLTTMNPKMCVS\LEASWIVRIIHAVSQFVFAINLPFCGPNRVGSFHCDF
PYVMKLACVDTYKLEVVVTANSGLISIATCFLLIISYIFISVTVXPSSGDLSKAFVSC/br/>SDHITVGILFFMPCIFLYVXLPKTTHDXLFIVP\LSPLSRIYTLRNKDMNVSMERLG
KWIAGSSRMSXMVH/PECKM

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
19 60,354 168,972 CopyNumber Variation_30879 (DGV)
19 60,070 172,370 CopyNumber Variation_73240 (DGV)
19 60,070 243,098 CopyNumber Variation_73242 (DGV)
19 60,179 119,175 CopyNumber Variation_78021 (DGV), Variation_89026 (DGV)
19 89,677 123,389 CopyNumber Variation_78022 (DGV)
19 89,677 165,529 CopyNumber Variation_78024 (DGV)
19 89,677 119,175 CopyNumber Variation_89027 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4G3P.aApr07-unspliced main_exon CDS_partial chr19 94,887 95,005 +
3UTR chr19 95,005 95,397 +