Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K13 Olfactory Receptor

Gene Symbol OR4K131 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases OR14-27, HsOR14.1.18, ORL3689
External Ids HGNC: 15351   GeneBank: AB065559, BK004449, NM_001004714   ORDB: ORL3689   
Build #39 labels OR4K13
Chromosomal location 14:20,033,847-20,034,758 (-)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K14 67.77% 301
OR4K15 68% 300
OR4K3P 64.33% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K13 92% 300
Dog OR4K13BP 91% 300
Chimp CONTIG*********** 99% 304
Mouse Or4k15 67% 300
Rat Or4k15 67% 300
Cow OR4K13 91% 300

Sequence information

Nucleotide sequence ATGGAAAGAGCAAACCATTCAGTGGTATCGGAATTTATTTTGTTGGGACTTTCCAAATCT
CAAAATCTTCAGATTTTATTCTTCTTGGGATTCTCTGTGGTCTTCGTGGGGATTGTGTTA
GGAAACCTGCTCATCTTGGTGACTGTGACCTTTGATTCGCTCCTTCACACACCAATGTAT
TTTCTGCTTAGCAACCTCTCCTGCATTGATATGATCCTGGCTTCTTTTGCTACCCCTAAG
ATGATTGTAGATTTCCTCCGAGAACGTAAGACCATCTCATGGTGGGGATGTTATTCCCAG
ATGTTCTTTATGCACCTCCTGGGTGGGAGTGAGATGATGTTGCTTGTAGCCATGGCAATA
GACAGGTATGTTGCCATATGCAAACCCCTCCATTACATGACCATCATGAGCCCACGGGTG
CTCACTGGGCTACTGTTATCCTCCTATGCAGTTGGATTTGTGCACTCATCTAGTCAAATG
GCTTTCATGTTGACTTTGCCCTTCTGTGGTCCCAATGTTATAGACAGCTTTTTCTGTGAC
CTTCCCCTTGTGATTAAACTTGCCTGCAAGGACACCTACATCCTACAGCTCCTGGTCATT
GCTGACAGTGGGCTCCTGTCACTGGTCTGCTTCCTCCTCTTGCTTGTCTCCTATGGAGTC
ATAATATTCTCAGTTAGGTACCGTGCTGCTAGTCGATCCTCTAAGGCTTTCTCCACTCTC
TCAGCTCACATCACAGTTGTGACTCTGTTCTTTGCTCCGTGTGTCTTTATCTACGTCTGG
CCCTTCAGCAGATACTCGGTAGATAAAATTCTTTCTGTGTTTTACACAATTTTCACACCT
CTCTTAAATCCTATTATTTATACATTAAGAAATCAAGAGGTAAAAGCAGCCATTAAAAAA
AGACTCTGCATA
Conceptual translation MERANHSVVSEFILLGLSKSQNLQILFFLGFSVVFVGIVLGNLLILVTVTFDSLLHTPMY
FLLSNLSCIDMILASFATPKMIVDFLRERKTISWWGCYSQMFFMHLLGGSEMMLLVAMAI
DRYVAICKPLHYMTIMSPRVLTGLLLSSYAVGFVHSSSQMAFMLTLPFCGPNVIDSFFCD
LPLVIKLACKDTYILQLLVIADSGLLSLVCFLLLLVSYGVIIFSVRYRAASRSSKAFSTL
SAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKK
RLCI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,502,044 20,502,044 NS G/T Q/K rs17277025 (DbSNP)
14 20,502,120 20,502,120 SYN C/T S/S rs17277032 (DbSNP)
14 20,033,885 20,033,885 NS G/T Q/K 1000GP (CEU, CHBJPT)
14 20,033,961 20,033,961 SYN C/T S/S 1000GP (CEU, CHBJPT)
14 20,034,443 20,034,443 NS G/A L/F 1000GP (CHBJPT)
14 100 -100 NS G/T Q/K 1000GP (YRI, YRI)
14 100 -100 SYN C/T P/P 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,371,142 20,505,020 CopyNumber Variation_2175 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,362,952 20,525,999 CopyNumber Variation_4827 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q292K P253L P138A L106F F102I V47M % Freq CORP
1 Q P P L F V 91.01 0.219
2 K P P L F V 5.91 0.219
3 Q P P L F M 1.23 0.219
4 Q P P F F V 0.92 0.219
5 Q P A L F V 0.61 0.219
6 Q P P L I V 0.23 0.219
7 Q L P L F V 0.08 0.302

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4K13.aApr07-unspliced main_exon 3UTR chr14 20,033,844 20,033,847 -
CDS chr14 20,033,847 20,034,758 -