Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K15 Olfactory Receptor

Gene Symbol OR4K151 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene No
CORP pseudogene probability score
Aliases OR14-20, HsOR14.1.15, ORL3690
External Ids HGNC: 15353   GeneBank: AB065560, BK004468, NM_001005486   ORDB: ORL3690   
Build #39 labels OR4K15
Chromosomal location 14:19,975,591-19,976,562 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K11P 94.03% 318
OR4K8P 93.71% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K15 94% 324
Chimp CONTIG794.7-1981 99% 324
Mouse Or4k15 94% 324
Rat Or4k15 94% 324
Cow OR4K15 92% 311

Expression evidences

Source Accession
mRNA BC140726

Sequence information

Nucleotide sequence ATGAATGAGACAAATCATTCTCGGGTGACAGAATTTGTGTTGCTGGGACTGTCTAGTTCA
AGGGAGCTCCAACCTTTCTTGTTTCTTACATTTTCACTACTTTATCTAGCAATTCTGTTG
GGCAACTTTCTCATCATCCTCACTGTGACCTCAGATTCCCGCCTTCACACCCCCATGTAC
TTTCTGCTTGCAAACCTGTCATTTATAGACGTATGTGTTGCCTCTTTTGCTACCCCTAAA
ATGATTGCAGACTTTCTGGTTGAGCGCAAGACTATTTCTTTTGATGCCTGCCTGGCCCAG
ATTTTCTTTGTTCATCTCTTCACTGGCAGTGAAATGGTGCTCCTAGTTTCCATGGCCTAT
GACCGTTATGTTGCTATATGCAAACCTCTCCACTACATGACAGTCATGAGCCGTCGTGTA
TGTGTTGTGCTCGTCCTCATTTCATGGTTTGTGGGCTTCATCCATACTACCAGCCAGTTG
GCATTCACTGTTAATCTGCCATTTTGTGGTCCTAATAAGGTAGACAGTTTTTTCTGTGAC
CTTCCTCTAGTGACCAAGTTAGCCTGCATAGACACTTATGTTGTCAGCTTACTAATAGTT
GCAGATAGTGGCTTTCTTTCTCTGAGTTCCTTTCTCCTCTTGGTTGTCTCCTACACTGTA
ATACTTGTTACAGTTAGGAATCGCTCCTCTGCAAGCATGGCGAAGGCCCGCTCCACATTG
ACTGCTCACATCACTGTGGTCACTTTATTCTTTGGACCATGCATTTTCATCTATGTGTGG
CCCTTCAGCAGTTACTCAGTTGACAAAGTCCTTGCTGTATTCTACACCATCTTCACGCTT
ATTTTAAACCCTGTAATCTACACGCTAAGAAACAAAGAAGTGAAGGCAGCTATGTCAAAA
CTGAAGAGTCGGTATCTGAAGCCTAGTCAGGTTTCTGTAGTCATAAGAAATGTTCTTTTC
CTAGAAACAAAG
Conceptual translation MNETNHSRVTEFVLLGLSSSRELQPFLFLTFSLLYLAILLGNFLIILTVTSDSRLHTPMY
FLLANLSFIDVCVASFATPKMIADFLVERKTISFDACLAQIFFVHLFTGSEMVLLVSMAY
DRYVAICKPLHYMTVMSRRVCVVLVLISWFVGFIHTTSQLAFTVNLPFCGPNKVDSFFCD
LPLVTKLACIDTYVVSLLIVADSGFLSLSSFLLLVVSYTVILVTVRNRSSASMAKARSTL
TAHITVVTLFFGPCIFIYVWPFSSYSVDKVLAVFYTIFTLILNPVIYTLRNKEVKAAMSK
LKSRYLKPSQVSVVIRNVLFLETK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,443,910 20,443,909 Ins(1) -/C rs35072765 (DbSNP)
14 20,444,441 20,444,441 NS A/C E/A rs10135246 (DbSNP)
14 20,443,943 20,443,943 NS A/G N/S rs4060024 (DbSNP)
14 20,444,012 20,444,012 NS A/T E/V rs3861512 (DbSNP)
14 20,444,607 20,444,607 NS C/G I/M rs10135467 (DbSNP)
14 20,444,393 20,444,393 NS C/T A/V rs45453894 (DbSNP)
14 20,444,152 20,444,152 NS G/A V/I rs2211209 (DbSNP)
14 20,444,138 20,444,138 NS T/C L/P rs2226036 (DbSNP)
14 20,444,588 20,444,588 NS T/C L/P rs2153466 (DbSNP)
14 20,444,026 20,444,026 NS T/G S/A rs3861513 (DbSNP)
14 20,444,193 20,444,193 SYN A/C S/S rs2318556 (DbSNP)
14 20,443,872 20,443,872 SYN C/G G/G rs4499148 (DbSNP)
14 20,444,490 20,444,490 SYN C/T V/V rs11158071 (DbSNP)
14 20,444,586 20,444,586 SYN G/A T/T rs72490142 (DbSNP)
14 19,975,867 19,975,867 NS T/G S/A 1000GP (CEU, CHBJPT)
14 19,976,282 19,976,282 NS C/A A/E 1000GP (CEU, CHBJPT)
14 19,976,448 19,976,448 NS C/G I/M 1000GP (CEU, CHBJPT)
14 19,976,429 19,976,429 NS T/C L/P 1000GP (CEU, CHBJPT)
14 19,976,034 19,976,034 SYN A/C S/S 1000GP (CEU, CHBJPT)
14 19,975,853 19,975,853 NS A/T E/V 1000GP (CEU, CHBJPT)
14 100 -100 NS A/T E/V 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,371,142 20,505,020 CopyNumber Variation_2175 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,362,952 20,525,999 CopyNumber Variation_4827 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M25R E112V R113H S117A R162H R252C A255E C278R V294D L304P I310M % Freq CORP
1 M E R S R R A C V L I 65.90 0.490
2 M V R A R R E C V P M 16.05 0.490
3 M E R S R R A C V P I 15.59 0.490
4 M E R S R R A R V P I 0.31 0.490
5 R V R A R R A C V P M 0.31 0.490
6 M E R S R R A C D L I 0.23 0.490
7 M V R A H R E C V P M 0.23 0.490
8 M E R S R C A C V L I 0.23 0.490
9 M V R A R R A C V P I 0.15 0.490
10 R V R A R R E C V P M 0.15 0.490
11 M V R A R R A C V P M 0.15 0.490
12 M E R A R R E C V P M 0.15 0.490
13 M E H S R R A C V P I 0.15 0.490
14 M E R S R R A C V P M 0.08 0.490
15 M E H S R R A C V L I 0.08 0.490
16 M E R S H R A C V L I 0.08 0.490
17 M E R S R R E C V P M 0.08 0.490
18 M V R A R R E C V L I 0.08 0.490

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4K15.aApr07-unspliced main_exon 5UTR chr14 19,975,519 19,975,591 +
CDS chr14 19,975,591 19,976,562 +
3UTR chr14 19,976,562 19,976,565 +