Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K17 Olfactory Receptor

Gene Symbol OR4K171 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.19 (functional)
Aliases OR14-29, HsOR14.1.22, ORL3691
External Ids HGNC: 15355   GeneBank: AB065891, BK004450, NM_001004715   ORDB: ORL3691   
Build #39 labels OR4K17
Chromosomal location 14:20,117,500-20,118,435 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K15 63.79% 301
OR4K3P 61.44% 306
OR4K5 60.33% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K14 62% 310
Chimp CONTIG5268.4-3617 96% 312
Mouse Or4k15 64% 301
Rat Or4k15 63% 307
Cow OR4K3 62% 308

Expression evidences

Source Accession
GNF Atlas2 gnf1h02179_at
GNF Atlas2 gnf1h11365_s_at

Sequence information

Nucleotide sequence ATGAAACTATTAAATCAATCTCAAGTGTCAGAATTCATTTTGCTGGGACTGACCAGCTCC
CAGGATGTAGAGTTTCTTCTCTTTGCCCTCTTCTCGGTTATCTATGTGGTCACAGTTTTG
GGTAACCTTCTTATTATAGTCACAGTGTTTAACACCCCTAACCTGAATACTCCCATGTAT
TTTCTCCTTGGTAATCTCTCTTTTGTAGATATGACCCTTGCTTCTTTTGCCACCCCTAAG
GTGATTCTGAACTTGTTAAAAAAGCAGAAGGTAATTTCTTTTGCTGGGTGCTTCACTCAG
ATATTTCTCCTTCACTTACTGGGTGGGGTTGAAATGGTACTGTTGGTCTCCATGGCTTTT
GACAGATATGTGGCCATTTGTAAGCCCCTACACTACATGACCATCATGAACAAGAAGGTA
TGTGTTTTGCTTGTAGTGACCTCATGGCTCTTGGGTCTCCTTCACTCAGGGTTTCAGATA
CCATTTGCTGTGAACTTGCCCTTTTGTGGTCCCAATGTGGTAGACAGCATTTTTTGTGAC
CTCCCTTTGGTTACTAAGCTTGCCTGTATAGACATATATTTTGTACAGGTAGTCATTGTT
GCCAACAGTGGCATAATCTCCCTGAGCTGTTTCATTATTTTGCTTATCTCCTACAGTCTG
ATCCTCATAACCATTAAGAACCACTCTCCTACTGGGCAATCTAAAGCCCGTTCCACTTTG
ACTGCTCACATCACAGTGGTGATTCTCTTCTTTGGCCCATGCATCTTTATCTACATTTGG
CCCTTCGGCAACCACTCTGTAGATAAGTTCCTTGCTGTGTTTTATACCATCATCACTCCT
ATCTTGAATCCAATTATCTATACTCTGAGAAACAAAGAAATGAAGATATCCATGAAAAAA
CTCTGGAGAGCTTTTGTGAATTCTAGAGAAGATACT
Conceptual translation MKLLNQSQVSEFILLGLTSSQDVEFLLFALFSVIYVVTVLGNLLIIVTVFNTPNLNTPMY
FLLGNLSFVDMTLASFATPKVILNLLKKQKVISFAGCFTQIFLLHLLGGVEMVLLVSMAF
DRYVAICKPLHYMTIMNKKVCVLLVVTSWLLGLLHSGFQIPFAVNLPFCGPNVVDSIFCD
LPLVTKLACIDIYFVQVVIVANSGIISLSCFIILLISYSLILITIKNHSPTGQSKARSTL
TAHITVVILFFGPCIFIYIWPFGNHSVDKFLAVFYTIITPILNPIIYTLRNKEMKISMKK
LWRAFVNSREDT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,586,532 20,586,532 NS A/C K/Q rs61751876 (DbSNP)
14 20,585,924 20,585,924 NS A/G Q/R rs61733476 (DbSNP)
14 20,586,042 20,586,042 NS C/G N/K rs8005245 (DbSNP)
14 20,586,432 20,586,432 SYN C/T Y/Y rs9323534 (DbSNP)
14 20,586,519 20,586,519 SYN C/T Y/Y rs12101112 (DbSNP)
14 20,117,883 20,117,883 NS G/C K/N 1000GP (CEU, CHBJPT)
14 20,117,765 20,117,765 NS A/G Q/R 1000GP (CEU)
14 20,118,273 20,118,273 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
14 100 -100 NS G/C K/N 1000GP (YRI)
14 100 -100 SYN C/T Y/Y 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,540,298 20,587,047 CopyNumber Variation_35235 (DGV)
14 20,585,559 20,588,594 Deletion #279 (Waszak)
14 20,585,466 20,585,692 Del(-15) #22(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q120R K159N R268H % Freq CORP
1 Q K R 56.84 0.434
2 Q N R 42.09 0.434
3 R N R 0.92 0.434
4 Q K H 0.08 0.434
5 Q N H 0.08 0.434

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4K17.aApr07-unspliced main_exon 5UTR chr14 20,117,407 20,117,500 +
CDS chr14 20,117,500 20,118,435 +
3UTR chr14 20,118,435 20,118,438 +