Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K2 Olfactory Receptor

Gene Symbol OR4K21 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases OR14-15, HsOR14.1.10, ORL3681
External Ids HGNC: 14728   GeneBank: AB065883, BK004357, NM_001005501   ORDB: ORL3681   
Build #39 labels OR4K2
Chromosomal location 14:19,876,268-19,877,209 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K3P 65.36% 306
OR4K6P 67.52% 314
OR4K7P 67.11% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K2 89% 313
Chimp CONTIG1808.6-17464 99% 314
Mouse Or4k2 83% 314
Rat Or4k2 83% 314
Cow OR4K2 88% 295

Expression evidences

Source Accession
mRNA BC136942

Sequence information

Nucleotide sequence ATGGATGTGGGCAATAAGTCTACCATGTCTGAATTTGTTTTGCTGGGGCTCTCTAATTCC
TGGGAACTACAGATGTTTTTCTTTATGGTGTTTTCATTGCTTTATGTGGCAACAATGGTG
GGTAACAGCCTCATAGTCATCACAGTTATAGTGGACCCTCACCTACACTCTCCTATGTAT
TTCCTGCTTACCAATCTTTCAATCATTGATATGTCTCTTGCTTCTTTCGCCACCCCAAAG
ATGATTACAGATTACCTAACAGGTCACAAAACCATCTCTTTTGATGGCTGCCTTACCCAG
ATATTCTTTCTCCACCTTTTCACTGGAACTGAGATCATCTTACTCATGGCCATGTCCTTT
GATAGGTATATTGCAATATGCAAGCCCCTGCACTATGCTTCTGTCATTAGTCCCCAGGTG
TGTGTTGCTCTCGTGGTGGCTTCCTGGATTATGGGAGTTATGCATTCAATGAGTCAGGTC
ATATTTGCCCTCACGTTACCATTCTGTGGTCCCTATGAGGTAGACAGCTTTTTCTGTGAC
CTTCCTGTGGTGTTCCAGTTGGCTTGTGTGGATACTTATGTTCTGGGCCTCTTTATGATC
TCAACAAGTGGCATAATTGCGTTGTCCTGTTTTATTGTTTTATTTAATTCATATGTTATT
GTCCTGGTTACTGTGAAGCATCATTCTTCCAGAGGATCATCTAAGGCCCTTTCTACTTGT
ACAGCTCATTTCATTGTTGTCTTCTTGTTCTTTGGGCCATGCATCTTCATCTACATGTGG
CCACTAAGCAGCTTTCTCACAGACAAGATTCTGTCTGTGTTTTATACCATCTTTACTCCC
ACTCTGAACCCAATAATCTATACTTTGAGGAATCAAGAAGTAAAGATAGCCATGAGGAAA
CTGAAAAATAGGTTTCTAAATTTTAATAAGGCAATGCCTTCA
Conceptual translation MDVGNKSTMSEFVLLGLSNSWELQMFFFMVFSLLYVATMVGNSLIVITVIVDPHLHSPMY
FLLTNLSIIDMSLASFATPKMITDYLTGHKTISFDGCLTQIFFLHLFTGTEIILLMAMSF
DRYIAICKPLHYASVISPQVCVALVVASWIMGVMHSMSQVIFALTLPFCGPYEVDSFFCD
LPVVFQLACVDTYVLGLFMISTSGIIALSCFIVLFNSYVIVLVTVKHHSSRGSSKALSTC
TAHFIVVFLFFGPCIFIYMWPLSSFLTDKILSVFYTIFTPTLNPIIYTLRNQEVKIAMRK
LKNRFLNFNKAMPS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,344,587 20,344,587 NS A/T H/L rs74036118 (DbSNP)
14 20,345,346 20,345,346 NS A/T N/I rs12883767 (DbSNP)
14 20,344,597 20,344,597 SYN C/T S/S rs74036119 (DbSNP)
14 19,877,187 19,877,187 NS A/T N/I 1000GP (CEU, CHBJPT)
14 19,876,421 19,876,421 NS G/A D/N 1000GP (CEU)
14 19,877,116 19,877,116 SYN C/T N/N 1000GP (CEU)
14 100 -100 NS T/C V/A 1000GP (YRI, YRI, YRI)
14 100 -100 SYN T/C S/S 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,197,616 20,399,048 CopyNumber Variation_0316 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,219,649 20,415,445 CopyNumber Variation_4826 (DGV)
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,239,479 20,422,583 CopyNumber Variation_8764 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,267,014 20,433,060 CopyNumber Variation_34563 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,239,246 20,432,988 CopyNumber Variation_34659 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 20,200,183 20,423,372 CopyNumber Variation_38951 (DGV)
14 20,305,431 20,404,091 CopyNumber Variation_49301 (DGV)
14 20,305,431 20,425,051 CopyNumber Variation_49302 (DGV), Variation_49303 (DGV)
14 20,305,431 20,432,664 CopyNumber Variation_49304 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,289,680 20,425,312 CopyNumber Variation_71860 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,326,958 20,419,574 CopyNumber Variation_76555 (DGV)
14 20,283,374 20,419,574 CopyNumber Variation_76556 (DGV)
14 20,332,406 20,370,542 CopyNumber Variation_76558 (DGV)
14 20,299,695 20,419,574 CopyNumber Variation_87113 (DGV)
14 20,344,427 20,345,371 InDel Variation_41259 (DGV)
14 20,344,327 20,347,368 CopyNumber #169 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q24H G41S V51A D52N H54L H56Y T165M N307I % Freq CORP
1 Q G V D H H T N 74.65 0.133
2 Q G V D H H T I 23.27 0.133
3 Q G V D L H T N 0.54 0.133
4 Q G A D H H T N 0.46 0.133
5 Q G V N H H T N 0.31 0.133
6 Q S V D H H T I 0.23 0.133
7 Q G V D H Y T N 0.23 0.133
8 H G V D H H T N 0.15 0.133
9 Q G V D H H M N 0.08 0.133
10 Q S V D H H T N 0.08 0.133

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4K2.aApr07-unspliced main_exon CDS chr14 19,876,268 19,877,209 +
3UTR chr14 19,877,209 19,877,212 +