Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4N2 Olfactory Receptor

Gene Symbol OR4N21 (View this gene in GeneCards)
Family 4
Subfamily N
Pseudogene No
CORP pseudogene probability score
Aliases OR14-8, OR14-13, HsOR14.1.7, ORL3693
External Ids HGNC: 14742   GeneBank: AB065885, BK004360, BK004473, NM_001004723   ORDB: ORL3693   
Build #39 labels OR4N2
Chromosomal location 14:19,827,449-19,828,369 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4N1P 87.09% 302
OR4N3P 91.86% 307
OR4N4 85.95% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4N2 90% 307
Chimp CONTIG1808.7-22772 99% 307
Mouse Or4n4b 81% 306
Mouse Or4n4 84% 306
Rat Or4n4 81% 306
Cow OR4N2 89% 307
Cow OR4N4 85% 306
Cow OR4N2C 86% 306

Expression evidences

Source Accession
ESTs BM696516
mRNA AB463965

Sequence information

Nucleotide sequence ATGGAAAGCGAGAACAGAACAGTGATAAGAGAATTCATCCTCCTTGGTCTGACCCAGTCT
CAAGATATTCAGCTCCTGGTCTTTGTGCTAGTTTTAATATTCTACTTCATCATCCTCCCT
GGAAATTTTCTCATTATTTTCACCATAAAGTCAGACCCTGGGCTCACAGCCCCCCTCTAT
TTCTTTCTGGGCAACTTGGCCTTCCTGGATGCATCCTACTCCTTCATTGTGGCTCCCCGG
ATGTTGGTGGACTTCCTCTCTGCGAAGAAGATAATCTCCTACAGAGGCTGCATCACTCAG
CTCTTTTTCTTGCACTTCCTTGGAGGAGGGGAGGGATTACTCCTTGTTGTGATGGCCTTT
GACCGCTACATCGCCATCTGCCGGCCTCTGCACTATCCTACTGTCATGAACCCTAGAACC
TGCTATGCAATGATGTTGGCTCTGTGGCTTGGGGGTTTTGTCCACTCCATTATCCAGGTG
GTCCTCATCCTCCGCTTGCCTTTTTGTGGCCCAAACCAGCTGGACAACTTCTTCTGTGAT
GTCCCACAGGTCATCAAGCTGGCCTGCACCGACACATTTGTGGTGGAGCTTCTGATGGTC
TTCAACAGTGGCCTGATGACACTCCTGTGCTTTCTGGGGCTTCTGGCCTCCTATGCAGTC
ATTCTTTGTCGCATACGAGGGTCTTCTTCTGAGGCAAAAAACAAGGCCATGTCCACGTGC
ATCACCCATATCATTGTTATATTCTTCATGTTTGGACCTGGCATCTTCATCTACACGCGC
CCCTTCAGGGCTTTCCCAGCTGACAAGGTGGTTTCTCTCTTCCACACAGTGATTTTTCCT
TTGTTGAATCCTGTCATTTATACCCTTCGCAACCAGGAAGTGAAAGCTTCCATGAAAAAG
GTGTTTAATAAGCACATAGCC
Conceptual translation MESENRTVIREFILLGLTQSQDIQLLVFVLVLIFYFIILPGNFLIIFTIKSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFLSAKKIISYRGCITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHYPTVMNPRTCYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD
VPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCRIRGSSSEAKNKAMSTC
ITHIIVIFFMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKK
VFNKHIA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS C/T P/S 1000GP (YRI, YRI)
14 100 -100 SYN G/A V/V 1000GP (YRI)
14 19,827,845 19,827,845 NS C/T P/S 1000GP (CEU, CHBJPT)
14 19,827,851 19,827,851 NS G/C V/L 1000GP (CEU, CHBJPT)
14 19,828,119 19,828,119 NS G/A R/H 1000GP (CHBJPT)
14 19,828,351 19,828,351 SYN G/A V/V 1000GP (CEU)
14 20,295,627 20,295,627 NS C/G T/R rs72663752 (DbSNP)
14 20,295,727 20,295,726 Ins(1) -/C rs34881110 (DbSNP)
14 20,295,763 20,295,763 SYN C/T D/D rs11621854 (DbSNP)
14 20,295,778 20,295,778 SYN A/C A/A rs11621883 (DbSNP)
14 20,295,779 20,295,779 NS C/G P/A rs11621884 (DbSNP)
14 20,295,834 20,295,834 NS T/C I/T rs2801164 (DbSNP)
14 20,295,980 20,295,980 NS G/A A/T rs4060171 (DbSNP)
14 20,295,990 20,295,990 NS T/G L/R rs2318280 (DbSNP)
14 20,296,000 20,296,000 NS C/G H/Q rs2873667 (DbSNP)
14 20,296,004 20,296,004 NS T/C S/P rs2318279 (DbSNP)
14 20,296,006 20,296,006 SYN A/T P/P rs2318278 (DbSNP)
14 20,296,010 20,296,010 NS C/G L/V rs17114261 (DbSNP)
14 20,296,025 20,296,025 NS G/A A/T rs2318277 (DbSNP)
14 20,296,201 20,296,201 SYN A/G L/L rs72484805 (DbSNP)
14 20,296,510 20,296,510 SYN A/G V/V rs10149365 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 19,670,757 20,331,117 CopyNumber Variation_37621 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 20,185,336 20,310,638 CopyNumber Variation_76557 (DGV)
14 20,197,616 20,399,048 CopyNumber Variation_0316 (DGV)
14 20,198,061 20,307,453 CopyNumber Variation_71859 (DGV)
14 20,200,183 20,423,372 CopyNumber Variation_38951 (DGV)
14 20,201,654 20,343,302 CopyNumber Variation_87118 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,219,649 20,415,445 CopyNumber Variation_4826 (DGV)
14 20,239,246 20,432,988 CopyNumber Variation_34659 (DGV)
14 20,239,479 20,422,583 CopyNumber Variation_8764 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,263,747 20,314,312 CopyNumber Variation_71834 (DGV)
14 20,267,014 20,433,060 CopyNumber Variation_34563 (DGV)
14 20,283,374 20,419,574 CopyNumber Variation_76556 (DGV)
14 20,289,680 20,425,312 CopyNumber Variation_71860 (DGV)
14 20,295,508 20,298,528 CopyNumber #158 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T7R I76T F85I P133S V135L R224H % Freq CORP
1 T I F P V R 43.01 0.490
2 T T F P V R 19.89 0.490
3 T T F S L R 16.82 0.490
4 T T F S V R 7.68 0.490
5 R I F P V R 7.22 0.490
6 T T F P V H 1.92 0.490
7 T I F S L R 1.84 0.490
8 T I F S V R 0.61 0.490
9 T T I P V R 0.54 0.490
10 T T F P L R 0.23 0.490
11 T I F P V H 0.15 0.490
12 T T F S L H 0.08 0.490

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4N2.aApr07 exon_5UTR chr14 19,803,770 19,803,844 +
main_exon 5UTR chr14 19,827,440 19,827,449 +
CDS_partial chr14 19,827,449 19,827,886 +
exon_3UTR chr14 19,830,048 19,830,226 +
OR4N2.bApr07 exon_5UTR chr14 19,719,015 19,719,116 +
exon_5UTR chr14 19,733,369 19,733,463 +
exon_5UTR chr14 19,761,888 19,761,983 +
exon_5UTR chr14 19,822,254 19,822,451 +
main_exon 5UTR chr14 19,827,440 19,827,449 +
CDS chr14 19,827,449 19,828,369 +
3UTR chr14 19,828,369 19,828,372 +