Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4R3P Olfactory Receptor

Gene Symbol OR4R3P1 (View this gene in GeneCards)
Family 4
Subfamily R
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3635
External Ids HGNC: 15182   GeneBank: NG_004230   ORDB: ORL3635   
Build #39 labels OR4R3P
Chromosomal location 11:49,923,050-49,923,887 (+)
Cluster 11@50
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4R1P 71.85% 270
OR4R2P 68.48% 257

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4C58 59% 206
Mouse Or4c58 60% 209
Rat Or4c58 59% 206
Cow OR4C21P 56% 209
Orang OR4C9P 53% 210
Horse OR4C2 54% 212
Chimp OR4R1P 77% 206

Sequence information

Nucleotide sequence ATGATAACCATCTTATGGGAAATATCTAAACCAGTAAATAATATTTTTCTAACACTTTCT
GTAAGATATCAAATGCTAATCACTACTGTGTCATAATTGTAAATGAAATTATAATATAAA
TTTACTGAGTTTTTCTGAGTACCTAATGAGTTAAAAAATATGGGAGCATATGTAGTACTG
TGCTTGTATCAATATGGATAAGGTATCTGGAAGTCTTTTCTGAACATCTTTCGGTGCTGC
TGAGATTATTCCACTGATGGGGATGGTCCATGGCTGCTATGTGACCATCTGCACTGCATG
AAAATCATGACTCAATATAGGTGTGGCCATCTTGCTGGAATGGCATGCACTGGAAGATTT
ATCCAGGCACAGTTTAGATCCTCTCCCCAGTCTGACTTCCTTTCTATAATTCCAATGTCA
CAATATGAATAGCCCATTCATATGTGACTTAAACACTTTGTTGAAGCTCCTCTGCATAGG
TAGTATGATACACTTGGTCTCTTTGTTGCTGCCAATGATGGGTTCAACTGCCTGTTAAAC
ATCATCTTCTTGATGGTTTCTTAAGTGGCCATCCTATATACTTTGAAATCCCACAGCTTG
GAGGAAAGATACAAAGCTCTCTCTACCTGTGTCTCTCACACCACCGTGGCCATCTAATTC
TTTGTGTTCTGTATACTTGTGTATCTGTGCCCAGTGACCCTTCCCCAGTCAGTAAAGCAG
TGGCTGTGCTTTACACCATGATAACGCCTACATTAAACCCTTTAGTCTAACCCTCAGAAA
TGCAGAGGTGAAAAGTGTTGAGAAACTTCTGGGTCAAAAGATGACTTGAAGAGAGAAA
Conceptual translation MITILWEISKPVNNIFLTLSVRYQMLITTV\NCKXYNINLLSFSEYLMSXI\SICS
TVLVSIWIRYLEVFSEH/FGAAEIIPLMGMVHGCYVTICTA/KIMTQYRCGHLAGMAC
TGRFI/GTVXLSPVXPFYNSNVTIXA/FICDLNTLLKLLCIGS/DTLGLFVAAN
DGFNCLLNIIFLMVSXAILYTLKSHSLEERYKALSTCVSHTTVAIXFVFCILVYLCPV
/PSPVSKAVAVLYTMITPTLNPLV/TLRNAEVKSVEKLLGQKMTXEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI)
11 49,923,322 49,923,322 SNP G/A 1000GP (CEU, CHBJPT)
11 49,923,730 49,923,730 SNP G/T 1000GP (CEU, CHBJPT)
11 49,923,776 49,923,776 SNP T/G 1000GP (CHBJPT)
11 49,923,873 49,923,873 SNP A/G 1000GP (CHBJPT)
11 49,944,631 49,944,631 SNP G/A rs2903410 (DbSNP)
11 49,944,780 49,944,780 SNP G/T rs73468971 (DbSNP)
11 49,944,874 49,944,874 SNP A/G rs7946556 (DbSNP)
11 49,945,282 49,945,282 SNP T/G rs1829949 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 49,732,291 50,117,547 CopyNumber Variation_6919 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.