Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4X2 Olfactory Receptor

Gene Symbol OR4X21 (View this gene in GeneCards)
Family 4
Subfamily X
Pseudogene No
CORP pseudogene probability score 0.44 (functional)
Aliases OR11-105, HsOR11.8.3, ORL3383
External Ids HGNC: 15184   GeneBank: AB065847, AF399580, BK004389, NM_001004727   ORDB: ORL3383   
Build #39 labels OR4X2
Chromosomal location 11:48,245,104-48,246,012 (+)
Cluster 11@48
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs7120775 (AA change=Y/* )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4B1 61.9% 294
OR4S2 60.73% 303
OR4X1 63.01% 292

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4X2 81% 303
Chimp CONTIG1131.57-1220 99% 303
Mouse Or4x6 79% 303
Rat Or4x6 78% 303
Cow OR4X2 79% 303
Cow OR4X2B 81% 303

Expression evidences

Source Accession
mRNA BC136936
GNF Atlas2 gnf1h10945_at

Sequence information

Nucleotide sequence ATGACTGAATTCATTTTTCTGGTACTTTCTCCCAACCAGGAGGTGCAGAGGGTTTGCTTT
GTGATATTTCTGTTCTTGTACACAGCAATTGTGCTGGGGAATTTCCTCATTGTGCTCACT
GTCATGACCAGCAGAAGCCTTGGTTCCCCCATGTACTTCTTCCTCAGCTACCTCTCCTTC
ATGGAGATCTGCTACTCCTCCGCTACAGCCCCCAAACTCATCTCAGATCTGCTGGCTGAA
AGGAAAGTCATATCTTGGTGGGGCTGCATGGCACAGCTTTTCTTCTTGCACTTCTTTGGT
GGCACTGAGATTTTCCTGCTCACTGTGATGGCCTATGACCACTATGTGGCCATCTGCAAG
CCCCTCAGCTACACCACCATCATGAACTGGCAGGTGTGTACTGTCCTTGTAGGAATAGCA
TGGGTGGGAGGCTTCATGCATTCCTTTGCACAAATCCTTCTCATCTTCCACCTGCTCTTC
TGTGGCCCCAATGTGATCAATCACTATTTCTGTGACCTAGTTCCCCTTCTCAAACTTGCC
TGCTCTGACACCTTCCTCATTGGTCTGCTGATTGTTGCCAATGGAGGCACCCTGTCTGTG
ATCAGTTTTGGGGTCCTCTTAGCATCCTATATGGTCATCTTGCTCCATCTGAGAACCTGG
AGCTCTGAAGGGTGGTGCAAAGCCCTCTCCACCTGTGGGTCCCATTTCGCTGTGGTTATC
TTGTTCTTTGGGCCCTGCGTCTTCAACTCTCTGAGGCCTTCTACCACTCTGCCCATAGAC
AAGATGGTGGCTGTGTTCTACACAGTGATAACCGCGATCCTGAACCCTGTCATCTACTCT
CTGAGAAATGCTGAAATGAGGAAGGCCATGAAGAGGCTGTGGATTAGGACATTGAGACTA
AATGAGAAA
Conceptual translation MTEFIFLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFLSYLSF
MEICYSSATAPKLISDLLAERKVISWWGCMAQLFFLHFFGGTEIFLLTVMAYDHYVAICK
PLSYTTIMNWQVCTVLVGIAWVGGFMHSFAQILLIFHLLFCGPNVINHYFCDLVPLLKLA
CSDTFLIGLLIVANGGTLSVISFGVLLASYMVILLHLRTWSSEGWCKALSTCGSHFAVVI
LFFGPCVFNSLRPSTTLPIDKMVAVFYTVITAILNPVIYSLRNAEMRKAMKRLWIRTLRL
NEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 nonsense SNP C/G Y/* 1000GP (YRI)
11 100 -100 NS G/C V/L 1000GP (YRI, YRI)
11 100 -100 SYN T/A T/T 1000GP (YRI)
11 48,245,184 48,245,184 nonsense SNP C/G Y/* 1000GP (CEU, CHBJPT)
11 48,245,427 48,245,427 SYN T/A T/T 1000GP (CEU, CHBJPT)
11 48,245,428 48,245,428 NS G/C V/L 1000GP (CEU, CHBJPT)
11 48,245,537 48,245,537 NS T/C F/S 1000GP (CEU)
11 48,245,986 48,245,986 NS A/G I/V 1000GP (CHBJPT)
11 48,266,736 48,266,736 nonsense SNP C/G Y/* rs7120775 (DbSNP)
11 48,266,857 48,266,857 NS G/T A/S rs61737299 (DbSNP)
11 48,267,468 48,267,468 SYN C/T T/T rs60356906 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E14K Y27* G144D % Freq CORP
1 E Y G 83.33 0.737
2 E * G 16.13 1.200
3 K Y G 0.38 0.737
4 E Y D 0.15 0.737

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4X2.aApr07-unspliced main_exon CDS chr11 48,245,104 48,246,012 +
3UTR chr11 48,246,012 48,246,015 +