Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51B3P Olfactory Receptor

Gene Symbol OR51B3P1 (View this gene in GeneCards)
Family 51
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.56P, ORL3477
External Ids HGNC: 14706   GeneBank: NG_004142   ORDB: ORL3477   
Build #39 labels OR51B3P
Chromosomal location 11:5,314,745-5,315,693 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51B2 60.78% 306
OR51B4 61.69% 308
OR51B5 59.74% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51B18 72% 305
Chimp CONTIG*********** 95% 318
Mouse Or51b17 68% 302
Rat Or51b17 71% 300
Cow OR51B20P 54% 298

Sequence information

Nucleotide sequence ACACACAATGCGGCTCCTTTTTTGCTGCCTGGCTTTTCAGTACTGGAGGCAACTTATCAC
TCGATCTCCATCCCCTTCTTTGCTGTTTATGTGTGCGTCCTTCTTGGCAATGGCAAGCTC
CTCTACCTCATCAAGCATGACCACAGTCTTCACGAACCCATGTACTGTTTCCTTGCCACA
CTGAGGCAAGACCTCATGGTGAAATTGACCATGATGCCCACTGTAATGGGCGTCTTGTGG
ATGAATCACAAAGAGGTTATCCATGGGGCCTGCTTCTTGCAGGTTTACATTATCCACTCC
CATTATCCACTTGCAGAATCAGGTATTCTCCTGTCAATGGCCTATGACCGTTTCATTATC
ATCCACATGCTTCTCAGGTATAACTATTTCTACTAAATCTTGGGTGAAGATAGAACTGTG
GCTATTTATGAGGGACTTTTTATCCCTCGTGCCTCCAATTCTGCCACTCCATTGCTTCCC
ATATTGTCATTCCCATGTTCTCTTCCACACCTTTTTTCTCCATCAAGATGTCCTGAAACT
TGCCTGTGCTGATATTACATTCAATCACTTATACCCAGCTATTCTGGTTGCTTTGATTTT
CTTCCTAGACGCTCTGATCATTGTCTTTTCTTATATCCTGATCCTTAAAACAGTTAAAGG
TATTGCCTCCAGAAAAGAGCAAGCCAAAGCTCTCAACATGTGTGTCTCCCATATCAGCTG
TGTCTTGGTATTTCACATCACCGTGATCAGTGAGACTTTCATTCACAGGTTTGGGAAACA
TGCACCACATGTGGTGCACATTACCGTGAGCTAATGACTCATTTCTTTTTCCTCCATTCA
TGAACCCTATTATATACAGCATCAAACCAAGCAGATCCAAAGAAGCATTGTTCGCCTATT
TTCTGGGCACAGAATGGCTTGAGCCCTTTTTTCAGAATTTTGTGATCTT
Conceptual translation THNAAPFLLPGFSVLEATYHSISIPFFAVYVCVLLGNGKLLYLIKHDHSLHEPMYCFLAT
LRQDLMVKLTMMPTVMGVLWMNHKEVIHGACFLQVYIIHSHYPLAESGILLSMAYDRFII
IHMLLRYN\STKSWVKIELWLFMRDFLSLVPPILPLHCFPYCHSHVLFHTFFLHQDVLK
LACADITFNHLYPAILVALIFFLDALIIVFSYILILKTVKGIASRKEQAKALNMCVSHIS
CVLVFHITVISETFIHRFGKHAPHVVHITVSXLI\FPPFMNPIIYSIKPSRSKEAL/
RLFSGHRMAXLFSEFCDL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 5,314,773 5,314,773 SNP C/A 1000GP (CHBJPT)
11 5,315,037 5,315,037 SNP T/A 1000GP (CEU, CHBJPT)
11 5,315,078 5,315,078 SNP C/A 1000GP (CEU)
11 5,315,173 5,315,173 SNP G/A 1000GP (CHBJPT)
11 5,315,245 5,315,245 SNP C/T 1000GP (CEU, CHBJPT)
11 5,315,326 5,315,326 SNP A/G 1000GP (CEU)
11 5,315,486 5,315,486 SNP T/A 1000GP (CEU, CHBJPT)
11 5,315,654 5,315,654 SNP C/T 1000GP (CEU, CHBJPT)
11 5,335,980 5,335,980 SNP A/C rs58254659 (DbSNP)
11 5,336,134 5,336,134 SNP A/G rs12274210 (DbSNP)
11 5,336,267 5,336,267 SNP A/T rs10837794 (DbSNP)
11 5,336,308 5,336,308 SNP A/C rs72873006 (DbSNP)
11 5,336,475 5,336,475 SNP C/T rs7942925 (DbSNP)
11 5,336,539 5,336,538 Ins(2) -/AG rs35605290 (DbSNP)
11 5,336,540 5,336,539 Ins(2) -/AG rs66607557 (DbSNP)
11 5,336,541 5,336,540 Ins(2) -/AG rs10643319 (DbSNP)
11 5,336,542 5,336,541 Ins(2) -/AG rs33955864 (DbSNP)
11 5,336,716 5,336,716 SNP A/T rs7932505 (DbSNP)
11 5,336,884 5,336,884 SNP C/T rs7946240 (DbSNP)
11 5,336,901 5,336,901 Del(1) -/A rs35335063 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.