Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51B4 Olfactory Receptor

Gene Symbol OR51B41 (View this gene in GeneCards)
Family 51
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.57 (pseudogene)
Aliases HsOR11.3.55, ORL482
External Ids HGNC: 14708   GeneBank: BC069094, NM_033179   ORDB: ORL482   
Build #39 labels OR51B4
Chromosomal location 11:5,301,017-5,301,946 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51B2 66.01% 306
OR51B5 65.02% 303
OR51B6 67.97% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51B4P 79% 301
Chimp CONTIG465.79-22060 96% 310
Mouse Or51b4 75% 311
Rat Or51b4 77% 304
Cow OR51B20P 65% 298

Expression evidences

Source Accession
ESTs BG492876
mRNA BC153815

Sequence information

Nucleotide sequence ATGTGGTATAACAACAGTGCTGGCCCCTTCTTGCTGACTGGCTTCTTGGGCTCAGAGGCA
GTTCACTACCGGATCTCTATGTCCTTCTTTGTCATCTACTTCTCCGTCCTTTTTGGAAAT
GGCACTCTTCTTGTCCTCATTTGGAATGATCACAGCCTCCATGAGCCCATGTACTACTTC
CTGGCTATGCTGGCAGACACGGACCTTGGGATGACATTCACTACAATGCCCACAGTCCTG
GGTGTCCTGCTGCTAGACCAGAGGGAGATTGCCCATGCTGCCTGTTTCACCCAATCCTTC
ATTCATTCACTGGCCATTGTAGAATCAGGTATCTTGCTTGTTTTGGCCTATGACTGTTTC
ATTGCCATCCGCACACCACTGAGGTACAACTGCATTCTTACCAATTCCCGAGTGATGAAC
ATAGGACTGGGGGTACTGATGAGAGGTTTTATGTCCATTTTGCCCATAATTCTTTCACTC
TACTGCTACCCATATTGTGGTTCCCGTGCCCTCTTGCACACATTTTGCCTCCATCAAGAT
GTCATAAAACTCGCCTGTGCTGATATCACGTTTAATCACATATATCCAATTATTCAGACT
TCTTTGACTGTCTTTTTAGATGCTCTAATCATCATCTTTTCTTATATACTAATCCTCAAG
ACAGTGATGGGCATTGCGTCTGGACAAGAGGAAGCTAAATCTCTCAACACTTGTGTCTCC
CATATTAGCTGTGTCCTAGTATTTCACATCACTGTGATGGGACTGTCATTCATTCACAGG
TTTGGGAAACATGCACCTCATGTGGTCCCCATTACCATGAGCTATGTCCATTTTCTCTTT
CCTCCATTCGTGAATCCTATCATTTATAGCATCAAGACCAAGCAGATTCAAAGAAGCATT
ATTCGCCTATTTTCTGGGCAGAGTAGGGCT
Conceptual translation MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYF
LAMLADTDLGMTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCF
IAIRTPLRYNCILTNSRVMNIGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQD
VIKLACADITFNHIYPIIQTSLTVFLDALIIIFSYILILKTVMGIASGQEEAKSLNTCVS
HISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLFPPFVNPIIYSIKTKQIQRSI
IRLFSGQSRA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T A/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A L/L 1000GP (YRI)
11 5,247,925 5,247,925 large insertion 87536bp insertion rs63751692 (DbSNP)
11 5,300,803 5,300,803 large insertion 31595bp insertion rs63751663 (DbSNP)
11 5,301,269 5,301,269 SYN C/T A/A 1000GP (CHBJPT)
11 5,301,290 5,301,290 SYN G/A L/L 1000GP (CEU, CHBJPT)
11 5,301,507 5,301,507 NS A/G M/T 1000GP (CEU, CHBJPT)
11 5,301,546 5,301,546 NS G/A T/I 1000GP (CHBJPT)
11 5,301,773 5,301,773 nonsense SNP G/C Y/* 1000GP (CHBJPT)
11 5,301,841 5,301,841 NS C/T V/I 1000GP (CEU, CHBJPT)
11 5,322,520 5,322,520 SYN A/G L/L rs12283334 (DbSNP)
11 5,322,606 5,322,606 NS A/G F/L rs57211922 (DbSNP)
11 5,322,624 5,322,624 NS T/C T/A rs62000994 (DbSNP)
11 5,322,660 5,322,660 NS G/T H/N rs74049368 (DbSNP)
11 5,322,674 5,322,674 NS G/A S/F rs62000995 (DbSNP)
11 5,322,737 5,322,737 NS A/G M/T rs10837771 (DbSNP)
11 5,322,768 5,322,768 NS C/G G/R rs62000996 (DbSNP)
11 5,323,071 5,323,071 NS C/T V/I rs7118113 (DbSNP)
11 5,323,161 5,323,161 NS T/C S/G rs61739194 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A310P T293I A226V A185T H173N S168F M147T R137G T134I L84M Y58* V36I S6G M1T % Freq CORP
1 A T A A H S T R T L Y I S M 42.09 0.641
2 A T A A H S M R T L Y V S M 29.19 0.641
3 A T A A H S M R T L Y I S M 21.12 0.641
4 A T A T H S M R T L Y V G M 2.76 0.641
5 A T A A H S M R I L Y I S M 0.92 0.641
6 A T V A H S M R T L Y V S M 0.69 0.641
7 A T A T H S M G T L Y V G M 0.54 0.641
8 A T A A H F M R T L Y V S M 0.46 0.641
9 P T A A H S T R T L Y I S M 0.38 0.641
10 A T A T H S M R T M Y V G M 0.38 0.641
11 A T A A H S M R T L Y I S T 0.31 1.200
12 A T A A H S T R T L Y V S M 0.23 0.641
13 A T A A H S T R I L Y I S M 0.23 0.641
14 A T A A N S M R T L Y I S M 0.23 0.735
15 P T A A H S T R T L * I S M 0.08 1.200
16 A T A T H S M R T L Y I S M 0.08 0.641
17 A T A A H S T R T L * I S M 0.08 1.200
18 A T A T H S M R T L Y V S M 0.08 0.641
19 A T A A H S M R T L Y V G M 0.08 0.641
20 A I A A H S M R T L Y V S T 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51B4.aApr07-unspliced main_exon 3UTR chr11 5,300,139 5,301,017 -
CDS chr11 5,301,017 5,301,946 -