Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51B8P Olfactory Receptor

Gene Symbol OR51B8P1 (View this gene in GeneCards)
Family 51
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.58P
External Ids HGNC: 31279   GeneBank: NG_004425   
Build #39 labels
Chromosomal location 11:5,330,588-5,331,345 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51B2 60.56% 251
OR51B5 62.9% 248
OR51B6 62.1% 248

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51B10 76% 251
Chimp CONTIG465.76-13440 63% 248
Chimp CONTIG465.79-22060 59% 251
Chimp CONTIG*********** 61% 248
Mouse Or51b6 63% 251
Rat Or51b6 64% 254
Cow OR51B20P 52% 252

Sequence information

Nucleotide sequence ACTGCTGCCCCTTTTCTCCTCACTGGCTTTCCAGGTCTGGAGAGATTTCATCCTTGGAGT
TCTATCTCCTTCTTTATCATCTATGTCTCTACAGTCCTTGGCAATGGCAGCCTCCTCCTC
TTTATCAGAGAAGACTGCACTCTTCATGAGCCCGTGTACTACTCTCTGACTATACTGGCA
GCCATAGACCTTGGTGTAACTTTGACAACAATGTCCACTGTCCTTGGTGTTCTCTGGCTA
GATCACAGGAAAATGAGCCATGGAGCCTGCTTCCTCCAGGCCTATCTAATCCACTCCCTC
TCTATCGTGGAGTCCAGAGTGTTGCTCATCATGGCCCATGACTGTTTTATTGGCATCCAT
AATCCCCTGAGATACACCTCCATTCTCACCAATGCTAAGGTGGTGAAGATAGATCTGGGG
GTTCAAATGAGGGGATTTGTTATGCTAATTGTGCCCATAATCATCACCCTCTCTGGATTC
CCCTACTGTCAATCCCATGTCCTCTCCCATGCTTTCTGCCTGCACCAGATGTGATCAAAC
TGGCCTGTGCAGACATCACCTTTAATAGACTTTATCCTATAGTCCTGGTCTCATCAACTG
GTTTCTTGGACTTTGTGCTTATCCTTATCTCTTACATTCTGATCCTTAAGAAGGTCATGG
GAATTGCCTCAGACAAGGAGCAGACTAAGGCCCTAAATACTTGTATTTCTCACATTAGCT
GTGTTCTGGTTTTTAATGTCACTTGATTGGGCTACCAC
Conceptual translation TAAPFLLT/LSRSGEISSLEFYL\FIIYVSTVLGNGSLLLFIREDCTLHEPVYYSLTI
LAAIDLGVTLTTMSTVLGVLWLDHRKMSHGACFLQAYLIHSLSIVESRVLLIMAHDCFIG
IHNPLRYTSILTNAKVVKIDLGVQMRGFVMLIVPIIITLSGFPYCQSHVLSHAFCL/PD
VIKLACADITFNRLYPIVLVSSTGFLDFVLILISYILILKKVMGIASDKEQTKALNTCIS
HISCVLVFNVTXGYH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI)
11 5,330,626 5,330,626 SNP A/G 1000GP (CEU)
11 5,331,228 5,331,228 SNP G/A 1000GP (CEU, CHBJPT)
11 5,331,229 5,331,229 SNP G/A 1000GP (CHBJPT)
11 5,331,270 5,331,270 SNP T/C 1000GP (CEU, CHBJPT)
11 5,331,278 5,331,278 SNP G/A 1000GP (CEU, CHBJPT)
11 5,351,856 5,351,856 SNP A/G rs72874668 (DbSNP)
11 5,352,161 5,352,161 SNP A/G rs59880821 (DbSNP)
11 5,352,366 5,352,366 SNP G/T rs74051710 (DbSNP)
11 5,352,458 5,352,458 SNP A/G rs57254266 (DbSNP)
11 5,352,500 5,352,500 SNP C/T rs11036868 (DbSNP)
11 5,352,517 5,352,516 Ins(3) -/CTA rs34871637 (DbSNP)
11 5,352,518 5,352,517 Ins(3) -/ACT rs72517829 (DbSNP)
11 5,352,519 5,352,518 Ins(3) -/ACT rs57790606 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 95 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.