Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51D1 Olfactory Receptor

Gene Symbol OR51D11 (View this gene in GeneCards)
Family 51
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-14, HsOR11.3.13, ORL3398
External Ids HGNC: 15193   GeneBank: AB065855, BK004370, NM_001004751   ORDB: ORL3398   
Build #39 labels OR51D1
Chromosomal location 11:4,639,791-4,640,762 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51E2 58.63% 307
OR51G2 54.67% 300
OR51I2 52.3% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51D1 91% 324
Chimp CONTIG465.145-49499 98% 324
Mouse Or51d1 89% 321
Rat Or51d1 88% 321
Cow OR51D1 85% 314

Expression evidences

Source Accession
mRNA BC140717
GNF Atlas2 gnf1h10685_at

Sequence information

Nucleotide sequence ATGCAGAAGCCCCAGCTCTTGGTCCCTATCATAGCCACTTCAAATGGAAATCTGGTCCAC
GCAGCATACTTCCTTTTGGTGGGTATCCCTGGCCTGGGGCCTACCATACACTTTTGGCTG
GCTTTCCCACTGTGTTTTATGTATGCCTTGGCCACCCTGGGTAACCTGACCATTGTCCTC
ATCATTCGTGTGGAGAGGCGACTGCATGAGCCCATGTACCTCTTCCTGGCCATGCTTTCC
ACTATTGACCTAGTCCTCTCCTCTATCACCATGCCCAAGATGGCCAGTCTTTTCCTGATG
GGCATCCAGGAGATCGAGTTCAACATTTGCCTGGCCCAGATGTTCCTTATCCATGCTCTG
TCAGCCGTGGAGTCAGCTGTCCTGCTGGCCATGGCTTTTGACCGCTTTGTGGCCATTTGC
CACCCATTGCGCCATGCTTCTGTGCTGACAGGGTGTACTGTGGCCAAGATTGGACTATCT
GCCCTGACCAGGGGGTTTGTATTCTTCTTCCCACTGCCCTTCATCCTCAAGTGGTTGTCC
TACTGCCAAACACATACTGTCACACACTCCTTCTGTCTGCACCAAGATATTATGAAGCTG
TCCTGTACTGACACCAGGGTCAATGTGGTTTATGGACTCTTCATCATCCTCTCAGTCATG
GGTGTGGACTCTCTCTTCATTGGCTTCTCATATATCCTCATCCTGTGGGCTGTTTTGGAG
CTGTCCTCTCGGAGGGCAGCACTCAAGGCTTTCAACACCTGCATCTCCCACCTCTGTGCT
GTTCTGGTCTTCTATGTACCCCTCATTGGGCTCTCGGTGGTGCATAGGCTGGGTGGTCCC
ACCTCCCTCCTCCATGTGGTTATGGCTAATACCTACTTGCTGCTACCACCTGTAGTCAAC
CCCCTTGTCTATGGAGCCAAGACCAAAGAGATCTGTTCAAGGGTCCTCTGTATGTTCTCA
CAAGGTGGCAAG
Conceptual translation MQKPQLLVPIIATSNGNLVHAAYFLLVGIPGLGPTIHFWLAFPLCFMYALATLGNLTIVL
IIRVERRLHEPMYLFLAMLSTIDLVLSSITMPKMASLFLMGIQEIEFNICLAQMFLIHAL
SAVESAVLLAMAFDRFVAICHPLRHASVLTGCTVAKIGLSALTRGFVFFFPLPFILKWLS
YCQTHTVTHSFCLHQDIMKLSCTDTRVNVVYGLFIILSVMGVDSLFIGFSYILILWAVLE
LSSRRAALKAFNTCISHLCAVLVFYVPLIGLSVVHRLGGPTSLLHVVMANTYLLLPPVVN
PLVYGAKTKEICSRVLCMFSQGGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,661,568 4,661,568 NS A/G Q/R rs61746547 (DbSNP)
11 4,661,424 4,661,424 NS A/G H/R rs61745314 (DbSNP)
11 4,661,925 4,661,925 NS C/T P/L rs11033139 (DbSNP)
11 4,661,243 4,661,243 NS C/T L/F rs61740347 (DbSNP)
11 4,661,285 4,661,285 NS G/A V/I rs905871 (DbSNP)
11 4,640,013 4,640,013 NS T/C F/L 1000GP (CEU, CHBJPT)
11 4,640,338 4,640,338 NS A/G Q/R 1000GP (CEU)
11 4,640,596 4,640,596 NS T/C I/T 1000GP (CEU)
11 4,640,633 4,640,633 SYN C/T T/T 1000GP (CEU)
11 4,640,055 4,640,055 NS A/G I/V 1000GP (CEU)
11 100 -100 NS T/C F/L 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,660,921 4,663,992 CopyNumber #154 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T57S F75L I89V K93T Q103R R135H G165V Q183R I269T % Freq CORP
1 T F I K Q R G Q I 79.26 0.024
2 T F V K Q R G Q I 13.90 0.024
3 T L I K Q R G R T 4.15 0.024
4 T F I K Q H G Q I 0.54 0.306
5 S F I K Q R G Q I 0.38 0.024
6 T F I T Q R G Q I 0.38 0.024
7 T F I K Q R V Q I 0.31 0.024
8 T L I K Q R G Q T 0.31 0.024
9 T L V K Q R G Q I 0.23 0.024
10 T F I K R R G Q I 0.15 0.024
11 T F V K Q R G Q T 0.08 0.024
12 T L I K Q R G R I 0.08 0.024
13 T F V K Q R G R I 0.08 0.024
14 T F I K Q R G Q T 0.08 0.024
15 T F I K Q R G R I 0.08 0.024

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51D1.aApr07-unspliced main_exon CDS chr11 4,639,791 4,640,762 +
3UTR chr11 4,640,762 4,640,765 +