Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51F5P Olfactory Receptor

Gene Symbol OR51F5P1 (View this gene in GeneCards)
Family 51
Subfamily F
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.18
External Ids HGNC: 31283   GeneBank: NG_004321   
Build #39 labels
Chromosomal location 11:4,709,569-4,710,510 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51C4P 70.17% 295
OR51F3P 70.85% 295
OR51F4P 71.67% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51C4 71% 312
Chimp CONTIG465.144-14139 96% 314
Mouse Or51f5 88% 312
Rat Or51f5 86% 312
Cow OR51F5 88% 314
Cow OR51F5B 88% 314
Cow OR51F5C 88% 314

Sequence information

Nucleotide sequence ATGCCATCCTTCAACCAGAGTATTTTCCACCCTGCAGTCTTCTTCCTTACTGGCATCCCT
GGCCTTGAAACCCGTCAGATCTGGACCTCCATCCCATTCTGTTGTCTCTATGTCATTGCT
ATCTCTGGGAATGGCATGATCCTGTTTGTCATCATCACTGAGTCAAGCCTCCATGAACCC
ATGTATCATTTTCTCTCCATGCTATCCTTCATGGACCTAGGTCTGTGTCTTTCTACATTG
ACCACCATGCTGGGTATTTTCTGGTTCAATGCTCGAGAAATCAGTTTTGATGCCTGCATT
GGCCAAATGTTCTTTATCCATGGCTTCACATTCATGGAGTCCTCAGTACTTTTGGCAATG
GCCTTTGACCGCTTTATTGCCGTCTGTAACCCACTGAGATATGCCACAATCTTAACCAAT
TCACGGATTATTAAAGTGGGCTTTGCAATTGTTCTTAGGGGAACAACAGCTCTAGTGCCT
CTACTCCTGCTCCTTAAGCGCCTCTCCTTCTGCCGTAGTCATGTGCTCCACCATTCCTAC
TGCTTCCACCCTGATGCGATGAAGCTCTCATGCACAGACACATGGATCAACAGTGCATTT
GGCCTGGCCATTGTTATCTCTACTGCTGGCTTAGACTCTGTCTTGATCCTCATCTCCTAT
GTTCTGATCGTCCGCTCTGTGCTCTGCATTGCCTCCCCAGAGGAGCAGAAAAAGGCTTTT
GGTACCTGTGTCTCTCACATCAGTGCAGTTGCCATCTTCTACATCCCCATGATCAGTTTG
TCACCAGTGCACAGATTTGGAAAGCATGCCCCTCCCCTTGTGCACATGCTCATTGCCAAT
GTTTATCTGCTTATCCCTCCTGTAATGAATCCCATAATCTACAGTGTAAAGACCAAGTAA
ATTCGCAAGGCTGTGCTCAAAGCATTTCTTTCTAAGCTAATT
Conceptual translation MPSFNQSIFHPAVFFLTGIPGLETRQIWTSIPFCCLYVIAISGNGMILFVIITESSLHEP
MYHFLSMLSFMDLGLCLSTLTTMLGIFWFNAREISFDACIGQMFFIHGFTFMESSVLLAM
AFDRFIAVCNPLRYATILTNSRIIKVGFAIVLRGTTALVPLLLLLKRLSFCRSHVLHHSY
CFHPDAMKLSCTDTWINSAFGLAIVISTAGLDSVLILISYVLIVRSVLCIASPEEQKKAF
GTCVSHISAVAIFYIPMISLSPVHRFGKHAPPLVHMLIANVYLLIPPVMNPIIYSVKTKXbr/>IRKAVLKAFLSKLI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,731,180 4,731,180 SNP A/G rs4432013 (DbSNP)
11 4,731,468 4,731,468 SNP A/G rs4436535 (DbSNP)
11 4,731,570 4,731,570 SNP A/G rs6578520 (DbSNP)
11 4,731,539 4,731,539 SNP C/T rs7109254 (DbSNP)
11 4,730,871 4,730,871 SNP C/T rs57324092 (DbSNP)
11 4,731,583 4,731,583 SNP C/T rs4471413 (DbSNP)
11 4,730,837 4,730,837 SNP C/T rs61743579 (DbSNP)
11 4,730,985 4,730,985 SNP C/T rs4619142 (DbSNP)
11 4,730,942 4,730,942 SNP G/T rs11033474 (DbSNP)
11 4,709,712 4,709,712 SNP G/T 1000GP (CEU)
11 4,709,755 4,709,755 SNP C/T 1000GP (CEU, CHBJPT)
11 4,709,950 4,709,950 SNP G/A 1000GP (CEU, CHBJPT)
11 4,710,238 4,710,238 SNP G/A 1000GP (CEU, CHBJPT)
11 4,710,353 4,710,353 SNP C/T 1000GP (CEU, CHBJPT)
11 4,709,811 4,709,811 SNP C/A 1000GP (CHBJPT)
11 4,710,241 4,710,241 SNP C/T 1000GP (CHBJPT)
11 100 -100 SNP C/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,730,699 4,733,740 CopyNumber #54 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.