Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51G2 Olfactory Receptor

Gene Symbol OR51G21 (View this gene in GeneCards)
Family 51
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-28, HsOR11.3.34, ORL3390
External Ids HGNC: 15198   GeneBank: AB065794, AY284517-AY284548, BK004285, NM_001005238   ORDB: ORL3390   
Build #39 labels OR51G2
Chromosomal location 11:4,914,722-4,915,663 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51E2 56.39% 305
OR51G1 63.82% 304
OR51L1 59.34% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51G2 93% 298
Chimp CONTIG465.124-6433 98% 287
Mouse Or51g2 91% 313
Rat Or51g2 91% 313
Cow OR51G2 89% 313
Cow OR51G2B 89% 301

Expression evidences

Source Accession
ESTs EG357696
mRNA BC136831
GNF Atlas2 gnf1h11097_at

Sequence information

Nucleotide sequence ATGACCCTGGGATCCCTGGGAAACAGCAGCAGCAGCGTTTCTGCTACCTTCCTGCTGAGT
GGCATCCCTGGGCTGGAGCGCATGCACATCTGGATCTCCATCCCACTGTGCTTCATGTAT
CTGGTTTCCATCCCGGGCAACTGCACAATTCTTTTTATCATTAAAACAGAGCGCTCACTT
CATGAACCTATGTATCTCTTCCTGTCCATGCTGGCTCTGATTGACCTGGGTCTCTCCCTT
TGCACTCTCCCTACAGTCCTGGGCATCTTTTGGGTTGGAGCACGAGAAATTAGCCATGAT
GCCTGCTTTGCTCAGCTCTTTTTCATTCACTGCTTCTCCTTCCTCGAGTCCTCTGTGCTA
CTGTCTATGGCCTTTGACCGCTTTGTGGCTATCTGCCACCCCTTGCACTATGTTTCCATT
CTCACCAACACAGTCATTGGCAGGATTGGCCTGGTCTCTCTGGGTCGTAGTGTAGCACTC
ATTTTTCCATTACCTTTTATGCTCAAAAGATTCCCCTATTGTGGCTCCCCAGTTCTCTCA
CATTCTTATTGTCTCCACCAAGAAGTGATGAAATTGGCCTGTGCCGACATGAAGGCCAAC
AGCATCTACGGCATGTTTGTCATCGTCTCTACAGTGGGTATAGACTCACTGCTCATCCTC
TTCTCTTATGCTCTGATCCTGCGCACCGTGCTGTCCATCGCCTCCAGGGCTGAGAGATTC
AAGGCCCTTAACACCTGTGTTTCCCACATCTGTGCTGTGCTGCTCTTCTACACTCCCATG
ATTGGCCTCTCTGTCATCCATCGCTTTGGAAAGCAGGCACCCCACCTGGTCCAGGTGGTC
ATGGGTTTCATGTATCTTCTCTTTCCTCCTGTGATGAATCCCATTGTCTACAGTGTGAAG
ACCAAACAGATCCGGGATCGAGTGACGCATGCCTTTTGTTAC
Conceptual translation MTLGSLGNSSSSVSATFLLSGIPGLERMHIWISIPLCFMYLVSIPGNCTILFIIKTERSL
HEPMYLFLSMLALIDLGLSLCTLPTVLGIFWVGAREISHDACFAQLFFIHCFSFLESSVL
LSMAFDRFVAICHPLHYVSILTNTVIGRIGLVSLGRSVALIFPLPFMLKRFPYCGSPVLS
HSYCLHQEVMKLACADMKANSIYGMFVIVSTVGIDSLLILFSYALILRTVLSIASRAERF
KALNTCVSHICAVLLFYTPMIGLSVIHRFGKQAPHLVQVVMGFMYLLFPPVMNPIVYSVK
TKQIRDRVTHAFCY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A P/S 1000GP (YRI, YRI, YRI)
11 4,915,378 4,915,378 NS C/G E/Q 1000GP (CEU)
11 4,915,383 4,915,383 NS G/T A/E 1000GP (CEU, CHBJPT)
11 4,936,401 4,936,401 NS G/A P/S rs61747513 (DbSNP)
11 4,936,412 4,936,412 Del(1) -/A rs35090253 (DbSNP)
11 4,936,608 4,936,608 NS C/G E/Q rs12419598 (DbSNP)
11 4,936,613 4,936,613 NS G/T A/E rs16907312 (DbSNP)
11 4,936,721 4,936,721 NS C/T R/H rs60718970 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 165 (Hasin)
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 4,933,952 4,936,993 CopyNumber #121 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I266N G204S P165S E96Q A94E M64T R58H I53V % Freq CORP
1 I G P E A M R I 72.58 0.038
2 I G P E E M R I 14.98 0.038
3 I G P Q A M R I 6.07 0.038
4 I G S E A M R I 3.69 0.038
5 I G P E A M H I 1.46 0.038
6 N G P E A M R I 0.38 0.038
7 I S P E A M R I 0.38 0.038
8 I G S E A M R V 0.23 0.038
9 I G P E A T R I 0.15 0.249
10 I G S E E M R I 0.08 0.038

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51G2.aApr07-unspliced main_exon 3UTR chr11 4,914,661 4,914,722 -
CDS chr11 4,914,722 4,915,663 -