Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51L1 Olfactory Receptor

Gene Symbol OR51L11 (View this gene in GeneCards)
Family 51
Subfamily L
Pseudogene No
CORP pseudogene probability score 0 (functional)
Aliases OR11-31, HsOR11.3.40, ORL3370
External Ids HGNC: 14759   GeneBank: AB065799, BK004317, NM_001004755   ORDB: ORL3370   
Build #39 labels OR51L1
Chromosomal location 11:4,998,983-4,999,927 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51F5P 55.48% 310
OR51G1 55.92% 304
OR51G2 59.34% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51L1 87% 311
Chimp CONTIG465.112-38535 99% 315
Mouse Or51l1-ps 88% 309
Rat Or51l1 88% 315
Cow OR51L1 87% 312
Cow OR51L1B 85% 301

Expression evidences

Source Accession
mRNA AB463974
GNF Atlas2 gnf1h10688_at

Sequence information

Nucleotide sequence ATGGGAGACTGGAATAACAGTGATGCTGTGGAGCCCATATTTATCCTGAGGGGTTTTCCT
GGACTGGAGTATGTTCATTCTTGGCTCTCCATCCTCTTCTGTCTTGCATATTTGGTAGCA
TTTATGGGTAATGTTACCATCCTGTCTGTCATTTGGATAGAATCCTCTCTCCATCAGCCC
ATGTATTACTTTATTTCCATCTTAGCAGTGAATGACCTGGGGATGTCCCTGTCTACACTT
CCCACCATGCTTGCTGTGTTATGGTTGGATGCTCCAGAGATCCAGGCAAGTGCTTGCTAT
GCTCAGCTGTTCTTCATCCACACATTCACATTCCTGGAGTCCTCAGTGTTGCTGGCCATG
GCCTTTGACCGTTTTGTTGCTATCTGCCATCCACTGCACTACCCCACCATCCTCACCAAC
AGTGTAATTGGCAAAATTGGTTTGGCCTGTTTGCTACGAAGCTTGGGAGTTGTACTTCCC
ACACCTTTGCTACTGAGACACTATCACTACTGCCATGGCAATGCCCTCTCTCACGCCTTC
TGTTTGCACCAGGATGTTCTAAGATTATCCTGTACAGATGCCAGGACCAACAGTATTTAT
GGGCTTTGTGTAGTCATTGCCACACTAGGTGTGGATTCAATCTTCATACTTCTTTCTTAT
GTTCTGATTCTTAATACTGTGCTGGATATTGCATCTCGTGAAGAGCAGCTAAAGGCACTC
AACACATGTGTATCCCATATCTGTGTGGTGCTTATCTTCTTTGTGCCAGTTATTGGGGTG
TCAATGGTCCATCGCTTTGGGAAGCATCTGTCTCCCATAGTCCACATCCTCATGGCAGAC
ATCTACCTTCTTCTTCCCCCAGTCCTTAACCCTATTGTCTATAGTGTCAGAACAAAGCAG
ATTCGTCTAGGAATTCTCCACAAGTTTGTCCTAAGGAGGAGGTTT
Conceptual translation MGDWNNSDAVEPIFILRGFPGLEYVHSWLSILFCLAYLVAFMGNVTILSVIWIESSLHQP
MYYFISILAVNDLGMSLSTLPTMLAVLWLDAPEIQASACYAQLFFIHTFTFLESSVLLAM
AFDRFVAICHPLHYPTILTNSVIGKIGLACLLRSLGVVLPTPLLLRHYHYCHGNALSHAF
CLHQDVLRLSCTDARTNSIYGLCVVIATLGVDSIFILLSYVLILNTVLDIASREEQLKAL
NTCVSHICVVLIFFVPVIGVSMVHRFGKHLSPIVHILMADIYLLLPPVLNPIVYSVRTKQ
IRLGILHKFVLRRRF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/T A/S 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G L/L 1000GP (YRI, YRI, YRI)
11 4,999,186 4,999,186 SYN A/G L/L 1000GP (CEU, CHBJPT)
11 4,999,279 4,999,279 SYN C/T C/C 1000GP (CEU, CHBJPT)
11 4,999,569 4,999,569 NS C/T T/I 1000GP (CEU, CHBJPT)
11 4,999,602 4,999,602 NS C/T A/V 1000GP (CEU)
11 4,999,825 4,999,825 NS C/G I/M 1000GP (CEU, CHBJPT)
11 5,020,231 5,020,231 NS A/C S/R rs61910724 (DbSNP)
11 5,020,416 5,020,416 SYN A/G L/L rs2445290 (DbSNP)
11 5,020,509 5,020,509 SYN C/T C/C rs11035066 (DbSNP)
11 5,020,799 5,020,799 NS C/T T/I rs10768448 (DbSNP)
11 5,020,832 5,020,832 NS C/T A/V rs10768450 (DbSNP)
11 5,020,861 5,020,861 NS C/T L/F rs61744618 (DbSNP)
11 5,020,933 5,020,933 NS A/T N/Y rs61729748 (DbSNP)
11 5,021,055 5,021,055 NS C/G I/M rs61734126 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 5,020,113 5,023,157 CopyNumber #57 (Waszak)
11 5,021,136 5,028,584 CopyNumber Variation_6920 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V10A A179S T196I A207V L222V N241Y H246Y I281M R302P % Freq CORP
1 V A T A L N H I R 64.75 0.005
2 V A I V L N H I R 22.27 0.005
3 V A T A L N H M R 9.06 0.005
4 V A T A L Y H I R 1.54 0.008
5 V A I A V N H I R 1.38 0.005
6 A A T A L N H M R 0.31 0.005
7 V S I V L N H I R 0.23 0.005
8 V A I V L N H I P 0.15 0.005
9 V A I A L N H I R 0.08 0.005
10 A A I V L N H M R 0.08 0.005
11 V A T A L N H I P 0.08 0.005
12 V A T A L N Y I R 0.08 0.067

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51L1.aApr07-unspliced main_exon CDS chr11 4,998,983 4,999,927 +
3UTR chr11 4,999,927 4,999,930 +