Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52K3P Olfactory Receptor

Gene Symbol OR52K3P1 (View this gene in GeneCards)
Family 52
Subfamily K
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.7P, ORL3562
External Ids HGNC: 15224   GeneBank: AB065554, AF143328, NG_004319   ORDB: ORL3562   
Build #39 labels OR52K3P
Chromosomal location 11:4,474,809-4,475,755 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52K1 83.44% 308
OR52K2 86.54% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52K1B 81% 313
Chimp CONTIG465.159-11183 97% 316
Mouse Or52k2 82% 305
Rat Or52k2 82% 305
Cow OR52K2 84% 305
Cow OR52K1 82% 308

Expression evidences

Source Accession
ESTs T83107
mRNA AF143328
GNF Atlas2 gnf1h10651_at

Sequence information

Nucleotide sequence ATGTCAGCCTCCAGTATCACCTCAACACATCCAACTTCCTTCTTGTTGATGGGGATTCCA
GGCCTGGAGCACCTGCACATCTGGATCTCCATCCCCTTCTCAGCATATACACTGGCCCTG
CTTGGAAACTGCACCCTCCTTCTCATCATCCAGGCTGATGCAGCCCTCCATGAGCCCATA
TACCTCTTTCTGGCCATGTTGGCAGCCATCGACCTGGTCCTTTCCTCCTCAGCATTGCCC
AAAATGCTTGCCATATTCTGGTTCAGGGATCGGGAGATCAACTTTTTTGCCTGTCTGGTC
CAGATGTTCTTCCTTCACTCCTTCTCCATCATGGAGTCAGCAGTGCTGCTGGCCATGGCC
TTTGACCGCTATGTGGCCATCTGCAAGCCACTGCACTACACCACGGTCCTGACTGGGTCC
CTCATCACCAAGATTGGCATGGCTGCTGTGGCCCGGGCTGTGACACTAATGACTCCACTC
CCCTTCCTGCTGAGATGTTTCCACTACTGCCGAGGCCCAGTGATTGCCCGCTGCTACTGT
GAACACATGGCTGTGGTCAGGCTGGCTGTGGGAACACTAGCTTCAACAATATCTATGGCA
TTGCTGTGGCCATGTTTATTGGAGTGTTGGATCTATTCTTTATCATCCTATCTTATATCT
TTATCCTTCAGGCAGTTCTACAACTCTCCTCTCAGGAGGCCCGCTACAAAGCATTTGGGA
CATGTGTCTCTCACATAGGTGCCATCTTAGCCTTCTACACACCTTCAGTCATCTCTTCAG
TCATGCACCGTGTGGCCCGCTGTGCTGCGCCACACGTCCACATTCTCCTCGCCAATTTCT
ATCTGCTCTTCCCACCCATGGTCAATCCCATCATCTACGGCGTTAAGACCAAGCAGATCC
GTGACAGTCTTGGGAGTATTCCCGAGAAAGGATGTGTGAATAGAGAG
Conceptual translation MSASSITSTHPTSFLLMGIPGLEHLHIWISIPFSAYTLALLGNCTLLLIIQADAALHEPI
YLFLAMLAAIDLVLSSSALPKMLAIFWFRDREINFFACLVQMFFLHSFSIMESAVLLAMA
FDRYVAICKPLHYTTVLTGSLITK\AWLLWPGLXXLHS/FLLRCFHYCRGPVIARC
YCEHMAVVRL/CGNTSFNNIYGIAVAMFIGVLDLFFIILSYIFILQAVLQLSSQEARYK
AFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKT
KQIRDSLGSIPEKGCVNRE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 4,474,878 4,474,878 SNP C/T 1000GP (CEU)
11 4,475,383 4,475,383 SNP C/A 1000GP (CEU, CHBJPT)
11 4,475,525 4,475,525 SNP G/A 1000GP (CHBJPT)
11 4,475,616 4,475,616 SNP C/T 1000GP (CEU, CHBJPT)
11 4,475,686 4,475,686 SNP C/T 1000GP (CEU, CHBJPT)
11 4,475,731 4,475,731 SNP C/T 1000GP (CEU, CHBJPT)
11 4,496,173 4,496,173 SNP C/T rs167946 (DbSNP)
11 4,496,212 4,496,212 SNP A/G rs331504 (DbSNP)
11 4,496,218 4,496,218 SNP A/G rs331505 (DbSNP)
11 4,496,416 4,496,416 SNP C/T rs60459115 (DbSNP)
11 4,496,492 4,496,492 SNP C/T rs28648512 (DbSNP)
11 4,496,613 4,496,613 SNP A/C rs9633905 (DbSNP)
11 4,496,755 4,496,755 SNP A/G rs2278169 (DbSNP)
11 4,496,846 4,496,846 SNP C/T rs2278170 (DbSNP)
11 4,496,916 4,496,916 SNP C/T rs2278171 (DbSNP)
11 4,496,961 4,496,961 SNP C/T rs2278172 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,055,945 4,510,188 CopyNumber Variation_3834 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52K3P.aApr07-unspliced main_exon CDS_partial chr11 4,475,240 4,475,755 +
3UTR chr11 4,475,755 4,476,395 +