Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52L1 Olfactory Receptor

Gene Symbol OR52L11 (View this gene in GeneCards)
Family 52
Subfamily L
Pseudogene No
CORP pseudogene probability score
Aliases OR11-50, HsOR11.3.92, ORL3285
External Ids HGNC: 14785   GeneBank: AB065819, AY284549-AY284580, BK004253, NM_001005173   ORDB: ORL3285   
Build #39 labels OR52L1
Chromosomal location 11:5,985,944-5,986,885 (-)
Cluster 11@6
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs4436525)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52L2P 91.4% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52L1 86% 313
Dog OR52L2 85% 313
Chimp CONTIG*********** 97% 314
Chimp CONTIG465.5-9765 92% 314
Mouse Or52l1 86% 313
Rat Or52l1 87% 313
Rat Or52l1b 87% 313
Cow OR52L1 87% 311
Cow OR52L2 87% 311

Expression evidences

Source Accession
mRNA BC137343

Sequence information

Nucleotide sequence ATGCTCCTTAGCAATTCAAGCTGGAGGCTATCCCAGCCTTCTTTTCTCCTGGTAGGGATT
CCAGGTTTAGAGGAAAGCCAGCACTGGATTGCACTGCCCCTGGGCATCCTTTACCTCCTT
GCTTTAGTGGGCAATGTTACCATTCTCTTCATCATCTGGATGGACCCATCCTTGCACCAA
TCTATGTACCTCTTCCTGTCCATGCTAGCTGCCATCGACCTGGTTCTGGCCTCCTCCACT
GCACCCAAAGCCCTTGCAGTGCTCCTGGTTCATGCCCACGAGATTGGGTACATCGTCTGC
CTGATCCAGATGTTCTTCATCCATGCATTCTCCTCCATGGAGTCAGGGGTACTTGTGGCC
ATGGCTCTGGATTGCTATGTAGCCATTTGTCACCCCTTGCACCATTCCACAATCCTGCAT
CCAGGGGTCATAGGGTGCATCGGAATGGTGGTGCTGGTGAGGGGATTACTACTCCTTATC
CCCTTCCCCATTTTGTTGGGAAAACTTATCTTCTGCCAAGCCACCATCATAGGCCATGCC
TATTGTGAACATATGGCTGTTGTGAAACTTGCCTGCTCAGAAACCACAGTCAATCGAGCT
TATGGGCTGACTATGGCCTTGCTTGTGATTGGGCTGGATGTTCTGGCCATTGGTGTTTCC
TATGCCCACATCCTCCAGGCAGTGCTGAAGGTACCAGGGAGTGAGGCCCGACTTAAGGCG
TTTAGCACATGTGGCTCTCATATTTGTGTCATCCTGGTCTTCTATGTCCCTGGAATTTTC
TCCTTCCTCACTCACCGCTTTGGTCATCATGTACCCCATCATGTCCATGTTCTTCTGGCC
ACATGGTATCTCCTCATGCCACCTGCGCTCAATCCTCTTGTCTATGGAGTGAAGACTCAG
CAGATCCGCCAGCGAGTGCTCAGAGTGTTTACACAAAAGGAT
Conceptual translation MLLSNSSWRLSQPSFLLVGIPGLEESQHWIALPLGILYLLALVGNVTILFIIWMDPSLHQ
SMYLFLSMLAAIDLVLASSTAPKALAVLLVHAHEIGYIVCLIQMFFIHAFSSMESGVLVA
MALDCYVAICHPLHHSTILHPGVIGCIGMVVLVRGLLLLIPFPILLGKLIFCQATIIGHA
YCEHMAVVKLACSETTVNRAYGLTMALLVIGLDVLAIGVSYAHILQAVLKVPGSEARLKA
FSTCGSHICVILVFYVPGIFSFLTHRFGHHVPHHVHVLLATWYLLMPPALNPLVYGVKTQ
QIRQRVLRVFTQKD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,007,410 6,007,409 Ins(1) -/G rs35528253 (DbSNP)
11 6,007,743 6,007,743 NS A/G C/R rs4436525 (DbSNP)
11 6,007,874 6,007,874 NS A/G V/A rs72484715 (DbSNP)
11 6,007,272 6,007,272 NS A/G W/R rs4237768 (DbSNP)
11 6,007,680 6,007,680 NS A/G C/R rs4436524 (DbSNP)
11 6,007,899 6,007,899 NS C/T D/N rs4501959 (DbSNP)
11 6,007,772 6,007,772 NS G/A S/L rs61750896 (DbSNP)
11 6,007,613 6,007,613 NS G/T T/K rs4354673 (DbSNP)
11 6,007,679 6,007,679 NS T/C Y/C rs61742092 (DbSNP)
11 6,007,294 6,007,294 SYN G/A H/H rs61752597 (DbSNP)
11 6,008,050 6,008,050 SYN G/A G/G rs61738944 (DbSNP)
11 6,007,396 6,007,396 SYN T/C A/A rs61732631 (DbSNP)
11 5,986,041 5,986,041 nonsense SNP C/T W/* 1000GP (CEU)
11 5,986,166 5,986,166 SYN C/T A/A 1000GP (CEU, CHBJPT)
11 5,986,669 5,986,669 NS C/T D/N 1000GP (CEU, CHBJPT)
11 5,986,450 5,986,450 NS A/G C/R 1000GP (CEU, CHBJPT)
11 5,986,042 5,986,042 NS A/G W/R 1000GP (CEU, CHBJPT)
11 5,986,383 5,986,383 NS T/G K/T 1000GP (CEU, CHBJPT)
11 100 -100 NS A/G W/R 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A V/V 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T326I R320Q W297R A255V K183T C161Y C161R C140R S130L D88N % Freq CORP
1 T R R A T C R R S D 52.69 0.288
2 T R R A T C R R S N 17.28 0.288
3 T R W A K C C C L D 10.14 0.288
4 T R R A K C C R S D 6.53 0.288
5 T R W A K C C C S D 4.69 0.288
6 T R R A T C R C S D 2.76 0.288
7 T R R V K C R R S D 1.38 0.288
8 T R R A K Y R R S D 1.15 0.288
9 T R R A K C C C S D 0.92 0.288
10 T R R A K C R R S D 0.61 0.288
11 T R R A T C R C S N 0.54 0.288
12 T Q W A K C C C L D 0.54 0.288
13 T R R A T C C R S D 0.15 0.288
14 T R W A K C R C L D 0.08 0.288
15 T R R V T C R R S N 0.08 0.288
16 I R R A T C R R S N 0.08 0.288
17 T R R A K C C R S N 0.08 0.288
18 T R W A T C R R S D 0.08 0.288
19 T R R A T C R R L N 0.08 0.288
20 T R W A K C C R S D 0.08 0.288
21 T R W A T C R C S D 0.08 0.288

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52L1.aApr07-unspliced main_exon 3UTR chr11 5,985,941 5,985,944 -
CDS chr11 5,985,944 5,986,885 -
5UTR chr11 5,986,885 5,986,930 -