Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52Q1P Olfactory Receptor

Gene Symbol OR52Q1P1 (View this gene in GeneCards)
Family 52
Subfamily Q
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.89P, ORL3525
External Ids HGNC: 15234   GeneBank: NG_004219   ORDB: ORL3525   
Build #39 labels OR52Q1P
Chromosomal location 11:5,903,635-5,904,478 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E2 41.67% 228
OR52E3P 40% 240
OR52E5 45.05% 202

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E25 46% 204
Chimp CONTIG*********** 88% 245
Mouse Or52e5 46% 204
Rat Or52e5b 47% 204
Cow OR52E1 46% 206

Sequence information

Nucleotide sequence TGCTTCAAGCCAATCTAAAAGAATTCAACTTTGTTTATTATTTCAAAATTTCAAGGCTGC
TGAAAGGTAGGTCTTTATACACAGTCACTTTATTTGCTAGCTGAGTATTTTCATCGGGGG
CAACTGATGAAAATGTTGACTTCCACTAACCTAAGCCTGTCCGTTGTTACTATCGTATCT
TCCAGTTCAACGTCAGGGAAATAGTTTTTGGTGCTTTCCTTGTTTATATACAGATGTTTA
TGACTTATCTATGCACTGGCCTGGAATCTGGGGTACTGATAATCCTGGCCATAGACCACT
ATGTCGTAATTCGCAATCCACTGAGATATACCATGATTCTCATGAACAATGTGGTAGCCA
TCCTAGGAAGTCATGATAATTAGATCTTTAATCTTTATCATCCCTTTTGAGTTTCTCATC
TTGCTGTTGTCATTCTGTGCTGCCCATATCATCCCCCACACCAAATGTGAGCACATGGGC
ATTGCCCATCTTTCCTGTGCCAGTATCAGAGCCAATAATATGTTTGGGATGGTTGCCTTT
TTGTGGGATTTATTGACCTTATTGCAATTGGTTTCTCCTATGTAAAGAAACTACACACTG
TTTCACTTACCACCATGGAATGGCCAGTTCGAGGCTCTCAATACCTGTGGTTCCCATGTT
TGTCATGCTCATCTTCTACATCCCAGTATTTTTTTTCTGATACACTGCTTGGTGAAAGCA
TCCCTGCTATATTCGTATATTTCTGGCCAATGTATATACGGTTGTTCTACCTGTATTCAA
CCCTGTTATCTATGGGATCAGGAAAAAACAGATCCCAGACTAGGGTATAGACCTAAAGAC
ATTT
Conceptual translation CFKPIXNSTLFIISKFQGCXRXFIHSHFICXSIFIGGNXKCXPLTXCPLLLSY
LPVQRQGNSFWCFPCL\QMFMTYLCTGLESGVLIILAIDHYVVIRNPLRYTMILMNNVV
AILGSHDNXFNLYH/LLS/LILLLSFCAAHIIPHTKCEHMGIAHLSCASIRANNMFG
MVAFLWDLLTLLQLVSPMXNYTLFHLPPWNGQFEALNTCGSHVCHAHLLHPS/F/FXbr/>YTAWXHPCYIRIFLANVYTVVLPVFNPVIYGIRKKQIPDXIDLKTF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,925,132 5,925,131 Ins(1) -/A rs36114926 (DbSNP)
11 5,925,129 5,925,129 SNP A/G rs10838806 (DbSNP)
11 5,925,369 5,925,369 SNP A/G rs17808328 (DbSNP)
11 5,925,561 5,925,561 SNP C/G rs11600820 (DbSNP)
11 5,925,178 5,925,178 SNP C/G rs4758183 (DbSNP)
11 5,925,317 5,925,317 SNP C/T rs72889307 (DbSNP)
11 5,925,073 5,925,073 SNP C/T rs73398301 (DbSNP)
11 5,925,432 5,925,432 SNP C/T rs11039518 (DbSNP)
11 5,925,649 5,925,649 SNP G/T rs10838807 (DbSNP)
11 5,903,899 5,903,899 SNP A/G 1000GP (CEU, CHBJPT)
11 5,903,948 5,903,948 SNP C/G 1000GP (CEU, CHBJPT)
11 5,904,139 5,904,139 SNP A/G 1000GP (CEU, CHBJPT)
11 5,904,202 5,904,202 SNP T/C 1000GP (CEU, CHBJPT)
11 5,904,419 5,904,419 SNP G/T 1000GP (CEU, CHBJPT)
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,921,129 5,963,801 CopyNumber Variation_6928 (DGV)
11 5,885,711 5,969,185 CopyNumber Variation_8676 (DGV)
11 5,885,711 5,934,044 CopyNumber Variation_8677 (DGV)
11 5,899,885 5,935,103 CopyNumber Variation_9650 (DGV), Variation_48860 (DGV), Variation_53917 (DGV)
11 5,899,885 5,935,102 CopyNumber Variation_29603 (DGV)
11 5,883,376 5,935,626 CopyNumber Variation_30541 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,885,709 5,935,510 CopyNumber Variation_37668 (DGV)
11 5,875,867 5,935,103 CopyNumber Variation_48859 (DGV)
11 5,899,885 5,959,757 CopyNumber Variation_53792 (DGV)
11 5,871,831 5,935,103 CopyNumber Variation_53856 (DGV)
11 5,924,765 5,927,708 CopyNumber #136 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.