Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52Z1P Olfactory Receptor

Gene Symbol OR52Z1P1 (View this gene in GeneCards)
Family 52
Subfamily Z
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.53P
External Ids HGNC: 19596   GeneBank: NG_004304   
Build #39 labels OR52Z1P
Chromosomal location 11:5,177,720-5,178,610 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a polymorphism of G->del at position 22 (rs11320735)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B6 60.27% 297
OR52D1 59.25% 292
OR52E8 59.66% 295

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52Z1 84% 300
Dog OR52Z1B 83% 300
Chimp CONTIG465.62-19284 58% 292
Chimp CONTIG465.57-42854 60% 297
Chimp CONTIG*********** 59% 295
Mouse Or52z1 82% 300
Rat Or52z1 81% 300
Cow OR52Z1 83% 300

Expression evidences

Source Accession
mRNA AB529243

Sequence information

Nucleotide sequence ATGGGAATCCCAGGGCTGGAAGGCTTGCATACCTGGATCTCCATCCCTTTTTCTTTTATG
TACATTGTGGCTGTTGCAGGCAATATCTTCTTGATCTTCCTGATCATGACTGAGCGCAGT
CTCCATGAGCCCATGTATCTCTTCCTATCCATGCTGGCCTCAGCCGACTTCCTGCTCGCC
ACTGCTGCAGCCCCTAAGGTGCTGGCTATCCTCTGGTTCCACTCCATGGACATATCCTTT
GGTAGTTGTGTGTCTCAGATGTTCTTCATACATTTCATCTTTGTGGCAGAATCTGCTATT
CTCCTGGCAATGGCATTTGACCGCTATGTGGCCATCTGTTACCCACTGAGATACACCATT
TTAACCTCATCAGCCGTCAGGAAGATTGGCATAGCAGCTGTGGTCAGGAGCTTTTTCATC
TGCTGTCCGTTCATCTTCCTGGTATACCGACTTACATATTGTGGGAGAAACATCATTCCT
CATTCCTACTGTGAGCACATTGCCAGATTGGCTTGTGGCAATATCAATGTCAATATCATT
TATGGCCTCACTGTGGCCCTACTCTCTACAGGACTGGATATAGTGCTTATCATTATATCC
TACACAATGATCCTTCACTCAGTGTTTCAGATATCTTCCTGGGCTGCCAGGTTCAAGGCC
CTTAGTACGTGCGGCTCTCATATCTGTGTCATATTTATGTTCTATACCCCAGCATTCTTT
TCATTTCTTGCCCATCGCTTTGGAGGTAAAACCATCCCTCACCACATTCACATCCTAGTG
GGCAGTCTCTATGTGTTAGTGCCCCCTATGCTAAACCCCATCATTTATGGGGTGAAGACC
AAACAAATTAAAGATCGAGTGATTTTGCTTTTCTCTCCTATCAGTGTATGC
Conceptual translation MGIPGLEGLHTWISIPFSFMYIVAVAGNIFLIFLIMTERSLHEPMYLFLSMLASADFLLA
TAAAPKVLAILWFHSMDISFGSCVSQMFFIHFIFVAESAILLAMAFDRYVAICYPLRYTI
LTSSAVRKIGIAAVVRSFFICCPFIFLVYRLTYCGRNIIPHSYCEHIARLACGNINVNII
YGLTVALLSTGLDIVLIIISYTMILHSVFQISSWAARFKALSTCGSHICVIFMFYTPAFF
SFLAHRFGGKTIPHHIHILVGSLYVLVPPMLNPIIYGVKTKQIKDRVILLFSPISVC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 5,159,765 5,159,765 large insertion 92848bp insertion rs63751674 (DbSNP)
11 5,168,239 5,168,239 large insertion 91130bp insertion rs63751649 (DbSNP)
11 5,174,207 5,174,207 large insertion 89773bp insertion rs63751660 (DbSNP)
11 5,177,811 5,177,811 SNP A/C 1000GP (CEU, CHBJPT)
11 5,177,978 5,177,978 SNP T/C 1000GP (CEU, CHBJPT)
11 5,177,992 5,177,992 SNP A/C 1000GP (CEU, CHBJPT)
11 5,178,203 5,178,203 SNP C/T 1000GP (CEU)
11 5,178,415 5,178,415 SNP T/C 1000GP (CEU, CHBJPT)
11 5,178,430 5,178,430 SNP T/C 1000GP (CEU, CHBJPT)
11 5,178,445 5,178,445 SNP C/T 1000GP (CEU, CHBJPT)
11 5,178,478 5,178,478 SNP T/A 1000GP (CEU, CHBJPT)
11 5,178,552 5,178,552 SNP A/G 1000GP (CEU)
11 5,190,915 5,190,915 large insertion 79137bp insertion rs63751690 (DbSNP)
11 5,193,765 5,193,765 large insertion 79487bp insertion rs63751678 (DbSNP)
11 5,199,208 5,199,208 SNP C/T rs7927539 (DbSNP)
11 5,199,222 5,199,222 SNP A/C rs7924390 (DbSNP)
11 5,199,342 5,199,341 Ins(6) -/ATGCCC rs67012514 (DbSNP)
11 5,199,344 5,199,343 Ins(6) -/CCCATG rs61208233 (DbSNP)
11 5,199,345 5,199,344 Ins(3) -/ATG rs67207242 (DbSNP)
11 5,199,490 5,199,490 SNP G/T rs74051402 (DbSNP)
11 5,199,528 5,199,528 SNP C/T rs73398632 (DbSNP)
11 5,199,645 5,199,645 SNP C/T rs6578560 (DbSNP)
11 5,199,660 5,199,660 SNP C/T rs6578561 (DbSNP)
11 5,199,675 5,199,675 SNP C/T rs6578562 (DbSNP)
11 5,199,708 5,199,708 SNP A/T rs6578563 (DbSNP)
11 5,199,776 5,199,776 SNP A/G rs74052703 (DbSNP)
11 5,199,818 5,199,818 Del(1) -/C rs5789371 (DbSNP)
11 5,199,819 5,199,819 Del(1) -/C rs11320735 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.