Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56A4 Olfactory Receptor

Gene Symbol OR56A41 (View this gene in GeneCards)
Family 56
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.49 (functional)
Aliases OR11-49, HsOR11.3.93, ORL3320
External Ids HGNC: 14791   GeneBank: AB065818, BK004255, NM_001005179   ORDB: ORL3320   
Build #39 labels OR56A4
Chromosomal location 11:6,002,054-6,002,992 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56A1 83.33% 312
OR56A5 87.22% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56A4 91% 313
Dog OR56A4C 89% 313
Dog OR56A4B 89% 313
Chimp CONTIG*********** 99% 313
Mouse Or56a4 87% 309
Mouse Or56a5 84% 312
Rat Or56a5 84% 312
Cow OR56A4P 89% 313
Cow OR56A4D 88% 313
Cow OR56A4E 89% 313

Expression evidences

Source Accession
mRNA BC136986

Sequence information

Nucleotide sequence ATGGCATCTCCCAGCAATGACTCCACTGCCCCAGTCTCTGAATTCCTCCTCATCTGCTTC
CCCAACTTCCAGAGCTGGCAGCACTGGTTGTCTCTGCCCCTCAGCCTTCTCTTCCTCCTG
GCCATGGGAGCTAACACCACCCTCCTGATCACCATCCAGCTGGAGGCCTCTCTGCACCAG
CCCCTGTACTACCTGCTCAGCCTCCTCTCCCTGCTGGACATCGTGCTCTGCCTCACCGTC
ATCCCCAAGGTCCTGGCCATCTTCTGGTTTGACCTCAGGTCGATCAGCTTCCCAGCCTGC
TTCCTCCAGATGTTCATCATGAACAGTTTTTTGACCATGGAGTCCTGCACGTTCATGGTC
ATGGCCTATGACCGTTATGTGGCCATCTGCCATCCATTGAGATACCCGTCTATCATCACT
GACCAGTTTGTGGCTAGGGCCGTGGTCTTTGTTATAGCCCGGAATGCCTTTGTTTCTCTT
CCTGTTCCCATGCTTTCTGCCAGGCTCAGATACTGTGCAGGAAACATAATCAAGAACTGC
ATCTGCAGTAACCTGTCTGTGTCCAAACTCTCTTGTGATGACATCACTTTCAATCAGCTC
TACCAGTTTGTGGCAGGCTGGACTCTGTTGGGCTCTGATCTTATCCTTATTGTTATCTCC
TATTCTTTTATATTGAAAGTTGTGCTTAGGATCAAGGCCGAGGGTGCTGTGGCCAAGGCC
TTGAGCACGTGTGGTTCCCACTTCATCCTCATCCTCTTCTTCAGCACAGTCCTGCTGGTT
CTGGTCATCACTAACCTGGCCAGGAAGAGAATTCCTCCAGATGTCCCCATCCTGCTCAAC
ATCCTGCACCACCTCATTCCCCCAGCTCTGAACCCCATTGTTTATGGTGTGAGAACCAAG
GAGATCAAGCAGGGAATCCAAAACCTGCTGAAGAGGTTG
Conceptual translation MASPSNDSTAPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEASLHQ
PLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFPACFLQMFIMNSFLTMESCTFMV
MAYDRYVAICHPLRYPSIITDQFVARAVVFVIARNAFVSLPVPMLSARLRYCAGNIIKNC
ICSNLSVSKLSCDDITFNQLYQFVAGWTLLGSDLILIVISYSFILKVVLRIKAEGAVAKA
LSTCGSHFILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK
EIKQGIQNLLKRL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,023,762 6,023,762 NS C/T R/Q rs17809527 (DbSNP)
11 6,023,640 6,023,640 NS C/T V/I rs11040249 (DbSNP)
11 6,023,581 6,023,581 SYN A/G L/L rs11040248 (DbSNP)
11 6,023,818 6,023,818 SYN A/G Y/Y rs10839221 (DbSNP)
11 6,002,351 6,002,351 SYN A/G L/L 1000GP (CEU, CHBJPT)
11 6,002,410 6,002,410 NS T/C I/V 1000GP (CEU, CHBJPT)
11 6,002,588 6,002,588 SYN G/A Y/Y 1000GP (CEU, CHBJPT)
11 100 -100 SYN A/G L/L 1000GP (YRI, YRI, YRI)
11 100 -100 NS T/C I/V 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 6,021,284 6,024,322 CopyNumber #64 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I247V R206Q % Freq CORP
1 I R 83.33 0.939
2 V R 16.44 0.939
3 V Q 0.23 0.939

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR56A4.aApr07-unspliced main_exon 3UTR chr11 6,002,051 6,002,054 -
CDS chr11 6,002,054 6,002,992 -
5UTR chr11 6,002,992 6,003,148 -