Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5A2 Olfactory Receptor

Gene Symbol OR5A21 (View this gene in GeneCards)
Family 5
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-248, HsOR11.13.5, ORL3302, ORL3303
External Ids HGNC: 15249   GeneBank: AB065805, AF399529, BK004308, NM_001001954   ORDB: ORL3302, ORL3303   
Build #39 labels OR5A2
Chromosomal location 11:59,421,982-59,422,953 (-)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5A1 67.33% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5A2 88% 320
Chimp CONTIG229.375-8510 98% 324
Mouse Or5a21 80% 318
Rat Or5a21 81% 318
Cow OR5A22P 74% 314

Expression evidences

Source Accession
mRNA BC136991
GNF Atlas2 gnf1h02105_at

Sequence information

Nucleotide sequence ATGGCTGTAGGAAGGAACAACACAATTGTGACAAAATTCATTCTCCTGGGACTTTCAGAC
CATCCTCAAATGAAGATTTTCCTTTTCATGTTATTTCTGGGGCTCTACCTCCTGACGTTG
GCCTGGAACTTAAGCCTCATTGCCCTCATTAAGATGGACTCTCACCTGCACATGCCCATG
TACTTCTTCCTCAGTAACCTGTCCTTCCTGGACATCTGCTATGTGTCCTCCACCGCCCCT
AAGATGCTGTCTGACATCATCACAGAGCAGAAAACCATTTCCTTTGTTGGCTGTGCCACT
CAGTACTTTGTCTTCTGTGGGATGGGGCTGACTGAATGCTTTCTCCTGGCAGCTATGGCC
TATGACCGGTATGCTGCAATCTGCAACCCCTTGCTTTACACAGTCCTCATATCCCATACA
CTTTGTTTAAAGATGGTGGTTGGCGCCTATGTGGGTGGATTCCTTAGTTCTTTCATTGAA
ACATACTCTGTCTATCAGCATGATTTCTGTGGGCCCTATATGATCAACCACTTTTTCTGT
GACCTCCCTCCAGTCCTGGCTCTGTCCTGCTCTGATACCTTCACCAGCGAGGTGGTGACC
TTCATAGTCAGTGTTGTCGTTGGAATAGTGTCTGTGCTAGTGGTCCTCATCTCTTATGGT
TACATTGTTGCTGCTGTTGTGAAGATCAGCTCAGCTACAGGTAGGACAAAGGCCTTCAGC
ACTTGTGCCTCTCACCTGACTGCTGTGACCCTCTTCTATGGTTCTGGATTCTTCATGTAC
ATGCGACCCAGTTCCAGCTACTCCCTAAACAGGGACAAGGTGGTGTCCATATTCTATGCC
TTGGTGATCCCCGTGGTGAATCCCATCATCTACAGTTTTAGGAATAAGGAGATTAAAAAT
GCCATGAGGAAAGCCATGGAAAGGGACCCCGGGATTTCTCACGGTGGACCATTCATTTTT
ATGACCTTGGGC
Conceptual translation MAVGRNNTIVTKFILLGLSDHPQMKIFLFMLFLGLYLLTLAWNLSLIALIKMDSHLHMPM
YFFLSNLSFLDICYVSSTAPKMLSDIITEQKTISFVGCATQYFVFCGMGLTECFLLAAMA
YDRYAAICNPLLYTVLISHTLCLKMVVGAYVGGFLSSFIETYSVYQHDFCGPYMINHFFC
DLPPVLALSCSDTFTSEVVTFIVSVVVGIVSVLVVLISYGYIVAAVVKISSATGRTKAFS
TCASHLTAVTLFYGSGFFMYMRPSSSYSLNRDKVVSIFYALVIPVVNPIIYSFRNKEIKN
AMRKAMERDPGISHGGPFIFMTLG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,190,252 59,190,252 Del(1) -/G rs60923897 (DbSNP)
11 59,190,120 59,190,120 NS A/G F/L rs17153691 (DbSNP)
11 59,189,912 59,189,912 NS A/G L/P rs1453547 (DbSNP)
11 59,422,647 59,422,647 NS A/G F/L 1000GP (CEU, CHBJPT)
11 59,422,439 59,422,439 NS G/A P/L 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M302R P172L R123Q F103L % Freq CORP
1 M P R F 79.72 0.156
2 M L R F 16.59 0.156
3 M P R L 3.30 0.156
4 R P R F 0.31 0.156
5 M P Q F 0.08 0.767

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5A2.aApr07-unspliced main_exon 3UTR chr11 59,421,979 59,421,982 -
CDS chr11 59,421,982 59,422,953 -