Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AK4P Olfactory Receptor

Gene Symbol OR5AK4P1 (View this gene in GeneCards)
Family 5
Subfamily AK
Pseudogene Yes
CORP pseudogene probability score
Aliases PJCG3, OR11-221, OR11-222, HsOR11.11.98P, ORL3632
External Ids HGNC: 15253   GeneBank: AF309700, AF309701, AY284037-AY284068, BK004784, BK004805, NG_002337   ORDB: ORL3632   
Build #39 labels OR5AK4P
Chromosomal location 11:57,037,534-57,038,458 (+)
Cluster 11@57
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AK1P 64.08% 309
OR5AK2 62.78% 309
OR5AK3P 62.34% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AK8 79% 309
Mouse Or5ak4 80% 307
Rat Or5ak4 80% 308
Cow OR5AK6 78% 309
Orang OR5AK3P 65% 308
Horse OR5AK33 78% 309
Chimp OR5AK1P 64% 309

Expression evidences

Source Accession
mRNA AF309700

Sequence information

Nucleotide sequence ATGGAACAAAATAATGGCACTGAAGTGACTGAATTCATTCTCCTGGGATTTGCTGGTCAA
CACAAGTCTTGGCATATCCTCTCCATAGCATTTCTAGCAATCTATGTGGTTACCCCAGTA
GGTAATATTGGAATGATCCTACTTATCAAAATTGATGCTTCTCTTCATATCCCCATGTAA
ATTTTCCTCCAACACTTGGCATTTGTTGATCTCTGTTACACCTCTGCTATCACTCCCAAG
ATGTTGAAAAACTTTGTAGAAACAAAAAAATCTATCTCATGTATAGGATGTATGGTGCAA
TTACTAGTTTATGGTACTTTGCAACAAGTGACTGCTACATCCTGGCTGCTATGGCAGTAG
ACCGTTATGTGGCCTTCTGTAACCCACTCCATTATCCAGGGGTTATGTCCCAGAGACTCT
GCATTAAGCTATTAGTTAGTTCATATGTCATGGGTTTCCTAAATGCCTCTATAAACATAA
GTTTCACTTTCTCATTGAACTTCTGCAAATCCAAAACAATTAATCACTTTTTCTGTGATG
AACCTCCAATTATTGCCCTACCATGCTCCAATATTGACCTCAACATCATGTTATTAACAG
TATTTGTGGGATTAAATTTGATGTGCACTGTGATGGTGGTCATCATTTCCTGCATATATG
TCCTGGTTGCCATCCTGAGGATATCTTCTGCTGCAGGGAAGAAAAAAGTCTCTCTACATG
TGCCTCCCACCTGACAGCAGTCACCATTTTCTATGGGGTTCTCTCTTACATGTATCTATG
CCATCGTATTAATGAGTCTCAAAAACAAGAAAAAGTGGCCTCTGTGTTTTATGGCATTAT
TATTCCCATGTTAAACCCCTTGATTTACAGCCAGAGAAACCAAGATGTGATTGAAGCCAT
AAAACTAACAGAAAAAAAGTATTTC
Conceptual translation MEQNNGTEVTEFILLGFAGQHKSWHILSIAFLAIYVVTPVGNIGMILLIKIDASLHIPMXbr/>IFLQHLAFVDLCYTSAITPKMLKNFVETKKSISCIGCMVQLLVYG/FATSDCYILAAMA
VDRYVAFCNPLHYPGVMSQRLCIKLLVSSYVMGFLNASINISFTFSLNFCKSKTINHFFC
DEPPIIALPCSNIDLNIMLLTVFVGLNLMCTVMVVIISCIYVLVAILRISSAAGKKKV/
STCASHLTAVTIFYGVLSYMYLCHRINESQKQEKVASVFYGIIIPMLNPLIYSQRNQDVI
EAIKLTEKKYF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI)
11 56,805,102 56,805,101 Ins(1) -/G rs35930052 (DbSNP)
11 56,805,122 56,805,122 SNP C/T rs11228882 (DbSNP)
11 56,805,235 56,805,235 SNP C/G rs71482300 (DbSNP)
11 56,805,626 56,805,626 SNP C/T rs17151502 (DbSNP)
11 56,805,652 56,805,652 SNP A/C rs72472124 (DbSNP)
11 57,037,647 57,037,647 SNP C/T 1000GP (CEU, CHBJPT)
11 57,037,736 57,037,736 SNP T/C 1000GP (CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AK4P.aApr07-unspliced main_exon CDS_partial chr11 57,037,884 57,038,400 +