Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AN1 Olfactory Receptor

Gene Symbol OR5AN11 (View this gene in GeneCards)
Family 5
Subfamily AN
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR11-244, HsOR11.13.3, ORL3453
External Ids HGNC: 15255   GeneBank: AB065806, BK004508, NM_001004729   ORDB: ORL3453   
Build #39 labels OR5AN1
Chromosomal location 11:59,364,459-59,365,391 (+)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AN2P 67.21% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AN1 83% 309
Dog OR5AN1E 83% 308
Dog OR5AN1D 82% 309
Dog OR5AN1FP 82% 238
Chimp CONTIG229.369-416 100% 294
Mouse Or5an1 82% 311
Mouse Or5an1b 80% 312
Rat Or5an1 80% 311
Rat Or5an1b 80% 312
Cow OR5AN1 80% 312

Expression evidences

Source Accession
mRNA BC140917
GNF Atlas2 gnf1h02107_at

Sequence information

Nucleotide sequence ATGACTGGGGGAGGAAATATTACAGAAATCACCTATTTCATCCTGCTGGGATTCTCAGAT
TTTCCCAGGATCATAAAAGTGCTCTTCACTATATTCCTGGTGATCTACATTACATCTCTG
GCCTGGAACCTCTCCCTCATTGTTTTAATAAGGATGGATTCCCACCTCCATACACCCATG
TATTTCTTCCTCAGTAACCTGTCCTTCATAGATGTCTGCTATATCAGCTCCACAGTCCCC
AAGATGCTCTCCAACCTCTTACAGGAACAGCAAACTATCACTTTTGTTGGTTGTATTATT
CAGTACTTTATCTTTTCAACGATGGGACTGAGTGAGTCTTGTCTCATGACAGCCATGGCT
TATGATCGTTATGCTGCCATTTGTAACCCCCTGCTCTATTCATCCATCATGTCACCCACC
CTCTGTGTTTGGATGGTACTGGGAGCCTACATGACTGGCCTCACTGCTTCTTTATTCCAA
ATTGGTGCTTTGCTTCAACTCCACTTCTGTGGGTCTAATGTCATCAGACATTTCTTCTGT
GACATGCCCCAACTGTTAATCTTGTCCTGTACTGACACTTTCTTTGTACAGGTCATGACT
GCTATATTAACCATGTTCTTTGGGATAGCAAGTGCCCTAGTTATCATGATATCCTATGGC
TATATTGGCATCTCCATCATGAAGATCACTTCAGCTAAAGGCAGGTCCAAGGCATTCAAC
ACCTGTGCTTCTCATCTAACAGCTGTTTCCCTCTTCTATACATCAGGAATCTTTGTCTAT
TTGAGTTCCAGCTCTGGAGGTTCTTCAAGCTTTGACAGATTTGCATCTGTTTTCTACACT
GTGGTCATTCCCATGTTAAATCCCTTGATTTACAGTTTGAGGAACAAAGAAATTAAAGAT
GCCTTAAAGAGGTTGCAAAAGAGAAAGTGCTGC
Conceptual translation MTGGGNITEITYFILLGFSDFPRIIKVLFTIFLVIYITSLAWNLSLIVLIRMDSHLHTPM
YFFLSNLSFIDVCYISSTVPKMLSNLLQEQQTITFVGCIIQYFIFSTMGLSESCLMTAMA
YDRYAAICNPLLYSSIMSPTLCVWMVLGAYMTGLTASLFQIGALLQLHFCGSNVIRHFFC
DMPQLLILSCTDTFFVQVMTAILTMFFGIASALVIMISYGYIGISIMKITSAKGRSKAFN
TCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD
ALKRLQKRKCC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,132,399 59,132,398 Ins(1) -/T rs34164503 (DbSNP)
11 59,132,798 59,132,798 NS C/G F/L rs7941190 (DbSNP)
11 59,132,486 59,132,486 SYN A/G L/L rs73480618 (DbSNP)
11 59,365,325 59,365,325 NS G/C L/F 1000GP (CEU, CHBJPT)
11 59,364,749 59,364,749 SYN T/C G/G 1000GP (CEU)
11 59,364,807 59,364,807 NS A/C T/P 1000GP (CHBJPT)
11 100 -100 SYN C/T F/F 1000GP (YRI, YRI)
11 100 -100 NS G/C G/A 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 59,131,832 59,134,864 CopyNumber #77 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G3R G162A T247K L289F % Freq CORP
1 G G T F 63.29 0.171
2 G G T L 35.41 0.171
3 R G T F 0.69 0.171
4 G A T L 0.31 0.171
5 G G K L 0.31 0.171

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AN1.aApr07-unspliced main_exon CDS chr11 59,364,459 59,365,391 +
3UTR chr11 59,365,391 59,365,394 +