Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AS1 Olfactory Receptor

Gene Symbol OR5AS11 (View this gene in GeneCards)
Family 5
Subfamily AS
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR11-168, HsOR11.11.41, ORL3307
External Ids HGNC: 15261   GeneBank: AB065452, AB065543, BK004344, NM_001001921   ORDB: ORL3307   
Build #39 labels OR5AS1
Chromosomal location 11:56,030,419-56,031,390 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AP2 55.48% 301
OR5AR1 55.74% 305
OR5I1 56.44% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AR1 57% 307
Mouse Or5as1 82% 309
Rat Or5as1 81% 309
Cow OR5AS1BP 82% 281
Orang OR5AU1 53% 307
Horse OR5AS3P 78% 299
Chimp OR5AP2 56% 303

Expression evidences

Source Accession
GNF Atlas2 gnf1h05457_at

Sequence information

Nucleotide sequence ATGTTGGAGAGTAATTACACCATGCCAACTGAGTTCCTATTTGTTGGATTCACAGATTAT
CTACCTCTCAGAGTCACACTGTTCTTGGTATTCCTTCTGGTATATACATTAACTATGGTC
GGAAATATACTCTTAATAATTCTAGTTAATATTAATTCAAGCCTTCAAATTCCCATGTAT
TATTTTCTTAGCAACTTATCTTTCTTAGACATCAGCTGTTCTACAGCAATCACTCCTAAA
ATGCTGGCAAACTTCTTGGCATCCAGGAAAAGCATCTCTCCTTATGGGTGTGCACTACAA
ATGTTTTTCTTCGCTTCTTTTGCTGATGCTGAGTGCCTTATCCTGGCAGCAATGGCTTAT
GACCGCTATGCAGCCATCTGCAACCCACTGCTCTATACTACACTGATGTCTAGGAGAGTC
TGTGTCTGCTTCATTGTGTTGGCATATTTCAGTGGAAGTACAACATCACTGGTCCATGTG
TGCCTCACATTCAGGCTGTCATTTTGTGGCTCCAATATCGTCAATCATTTTTTCTGTGAT
ATCCCACCTCTTCTGGCTTTATCATGTACAGACACTCAGATCAACCAGCTTCTGCTCTTT
GCTTTGTGCAGCTTCATCCAGACCAGCACTTTTGTGGTAATATTTATTTCTTACTTCTGC
ATCCTCATCACTGTGTTGAGCATCAAGTCCTCAGGTGGCAGAAGCAAAACATTCTCCACT
TGTGCTTCCCACCTCATAGCAGTCACCTTATTCTATGGAGCGCTCCTGTTTATGTACTTA
CAGCCCACCACTAGCTATTCCCTAGACACTGATAAGGTGGTGGCAGTGTTTTATACTGTT
GTATTTCCCATGTTTAATCCAATAATTTATAGTTTCAGAAACAAGGATGTGAAAAATGCT
CTCAAAAAGCTATTAGAAAGAATTGGATATTCAAATGAATGGTATTTAAATCGTTTAAGA
ATAGTCAATATC
Conceptual translation MLESNYTMPTEFLFVGFTDYLPLRVTLFLVFLLVYTLTMVGNILLIILVNINSSLQIPMY
YFLSNLSFLDISCSTAITPKMLANFLASRKSISPYGCALQMFFFASFADAECLILAAMAY
DRYAAICNPLLYTTLMSRRVCVCFIVLAYFSGSTTSLVHVCLTFRLSFCGSNIVNHFFCD
IPPLLALSCTDTQINQLLLFALCSFIQTSTFVVIFISYFCILITVLSIKSSGGRSKTFST
CASHLIAVTLFYGALLFMYLQPTTSYSLDTDKVVAVFYTVVFPMFNPIIYSFRNKDVKNA
LKKLLERIGYSNEWYLNRLRIVNI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/T R/L 1000GP (YRI, YRI, YRI)
11 100 -100 SYN G/A L/L 1000GP (YRI, YRI, YRI)
11 55,798,112 55,798,112 NS G/T C/F rs61307184 (DbSNP)
11 55,798,152 55,798,152 SYN A/G L/L rs1482011 (DbSNP)
11 55,798,237 55,798,237 SYN C/T L/L rs17528782 (DbSNP)
11 55,798,259 55,798,259 NS G/T R/L rs12224086 (DbSNP)
11 55,798,533 55,798,533 SYN A/C V/V rs17528803 (DbSNP)
11 55,798,761 55,798,761 SYN C/T I/I rs61889974 (DbSNP)
11 55,798,764 55,798,764 SYN C/T Y/Y rs61889975 (DbSNP)
11 55,798,779 55,798,778 Ins(1) -/G rs35555163 (DbSNP)
11 55,798,823 55,798,823 NS A/G Y/C rs17600939 (DbSNP)
11 56,030,676 56,030,676 SYN G/A L/L 1000GP (CEU, CHBJPT)
11 56,030,761 56,030,761 SYN C/T L/L 1000GP (CEU)
11 56,030,783 56,030,783 NS G/T R/L 1000GP (CEU, CHBJPT)
11 56,031,057 56,031,057 SYN A/C V/V 1000GP (CEU)
11 56,031,285 56,031,285 SYN T/C I/I 1000GP (CEU)
11 56,031,288 56,031,288 SYN T/C Y/Y 1000GP (CEU)
11 56,031,347 56,031,347 NS A/G Y/C 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,683,109 55,833,490 CopyNumber Variation_85786 (DGV)
11 55,685,556 55,819,544 CopyNumber Variation_29912 (DGV), Variation_48846 (DGV)
11 55,685,556 55,836,620 CopyNumber Variation_48847 (DGV)
11 55,685,799 55,842,512 CopyNumber Variation_9189 (DGV)
11 55,689,863 55,849,156 CopyNumber Variation_2927 (DGV)
11 55,797,795 55,800,866 Deletion #219 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I47M C73F R122L E306G Y310C % Freq CORP
1 I C R E Y 83.72 0.195
2 I C L E Y 10.14 0.812
3 I C R E C 4.84 0.195
4 I C R G Y 0.77 0.195
5 M C R E Y 0.31 0.195
6 I F R E Y 0.23 0.195

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AS1.aApr07-unspliced main_exon CDS chr11 56,030,419 56,031,390 +
3UTR chr11 56,031,390 56,031,393 +