Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B1P Olfactory Receptor

Gene Symbol OR5B1P1 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR8-122, OR8-123, OR8-123, OR912-92, OR912-92, OR3-144, OR3-144, OR11-242, OR6-55, OR6-55, OR6-57, OR6-57, HsOR11.12.18P, ORL3209
External Ids HGNC: 8322   GeneBank: AF399501, BK004806, NG_002305, U86263, U86276, U86277, U86284, U86299   ORDB: ORL3209   
Build #39 labels OR5B5P, OR5B1P, OR5B14P, OR5B7P
Chromosomal location 11:58,365,830-58,366,763 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B17 72.58% 310
OR5B2 75.9% 307
OR5B3 80.65% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B2B 83% 309
Mouse Or5b3 77% 307
Rat Or5b95 76% 310
Cow OR5B141 76% 310
Orang OR5B3P 79% 310
Horse OR5B157 81% 310
Horse OR5B3 80% 312
Horse OR5B158 81% 310
Chimp OR5B3 81% 310

Sequence information

Nucleotide sequence ATGAAGAACTGTACAGAAGTGACAGAGTTCATCCTCCTGGGACTAACCAATGCTCCAGAG
CTACAAGTCCCCCTCCTTATCATGTTCACTCTCATATACCTTGTCAATGTGGTTGGAAAC
CTGGGGATGATTGTTTTAATTGTTTGGGACATTCATCTCCACACTCCCATGTATTTTTTC
CTCAGTCACCTGTCTCTAGTGGACTTTTGTTACTCTTCAGCTGTCACTCCCACAGTCATA
GCTGGGCTCGTTATAGGAGACAAGGTCATCTCTTACAATGCATGTGCTGCTCAAATGTTC
TTTTTTGCAGCCTTTGCCACTGTGGAAAATTTCCTCTTGGCCTCAATGGCCTATGACCGC
TATGATGCAGTGTGCAAACCCCTACATTACACCACCACCATGACAACAAGTGTGTGTGCA
TGTCTGGCTATAATCTGTTATGTCTGTGGTTTCTTGAATGCCTCCATACACATTGGGGAA
ACATTGTCTCTCTTTCTGTATGTCCAATGAAGTCCATTGCTTTTTCTGTGATGTTCCACC
AGTCATGGCTCTGTCTTGCTGTGATAGACATGTGAATGAGCTAGTTCTCATTTATGTAGC
CAGTTTCAATATCTTTTCTGCCATCCTAGTTATCTTGATCTCCTACCTATTCATATTTAT
CACCATCCTAAAGATGCACTCAGCTTCAGGATACCAGAAGGCTTTGTCCACCTGTGCCTC
CCACCTCACTGCAGTCATCATCTTCTATGGGACTATTATCTTCATGTACTTACAGCCCAG
CTCTGGTCACTCCATGGACACAGACAAACTGGCATCTGTGTTCTATACTATGATCATCCC
CATGCTGAACCCCCTGGTCTATAGCCTGAGGAACAACGAAGTGAAGAGCGCATTCAAGAA
AGTTATTGAGAAGGCAAAATTGTCTCTATTATTG
Conceptual translation MKNCTEVTEFILLGLTNAPELQVPLLIMFTLIYLVNVVGNLGMIVLIVWDIHLHTPMYFF
LSHLSLVDFCYSSAVTPTVIAGLVIGDKVISYNACAAQMFFFAAFATVENFLLASMAYDR
YDAVCKPLHYTTTMTTSVCACLAIICYVCGFLNASIHIGET//LSFCMSNEVHCFFCD
VPPVMALSCCDRHVNELVLIYVASFNIFSAILVILISYLFIFITILKMHSASGYQKALST
CASHLTAVIIFYGTIIFMYLQPSSGHSMDTDKLASVFYTMIIPMLNPLVYSLRNNEVKSA
FKKVIEKAKLSLLL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI)
11 58,133,459 58,133,458 Ins(1) -/G rs34391799 (DbSNP)
11 58,133,611 58,133,611 SNP G/T rs57282455 (DbSNP)
11 58,133,738 58,133,738 SNP A/T rs11601791 (DbSNP)
11 58,134,150 58,134,150 SNP C/G rs12283305 (DbSNP)
11 58,365,896 58,365,896 SNP C/G 1000GP (CEU)
11 58,366,265 58,366,265 SNP A/T 1000GP (CEU, CHBJPT)
11 58,366,617 58,366,617 SNP C/T 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.