Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5C1 Olfactory Receptor

Gene Symbol OR5C11 (View this gene in GeneCards)
Family 5
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.22 (functional)
Aliases hRPK-465_F_21, OR9-F, OR9-31, HsOR9.6.14, ORL3245
External Ids HGNC: 8331   GeneBank: AB065725, AF399514, BK004233, NM_001001923   ORDB: ORL3245   
Build #39 labels OR5C2P, OR5C1
Chromosomal location 9:122,788,933-122,789,892 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AR1 57.68% 293
OR5W2 58.36% 293

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5C1 86% 316
Chimp CONTIG291.315-2598 98% 320
Mouse Or5c1 85% 320
Rat Or5c1 85% 320
Cow OR5C1 82% 320

Expression evidences

Source Accession
ESTs CV366136
mRNA BC136701
GNF Atlas2 gnf1h10870_at

Sequence information

Nucleotide sequence ATGAACTCAGAGAACCTCACCCGGGCCGCGGTTGCCCCTGCTGAATTCGTCCTCCTGGGC
ATCACAAATCGCTGGGACCTGCGTGTGGCCCTCTTCCTGACCTGCCTGCCTGTCTACCTG
GTGAGCCTGCTGGGAAACATGGGCATGGCGCTGCTGATCCGCATGGATGCCCGGCTCCAC
ACACCTATGTACTTCTTCCTGGCCAACCTCTCCCTGCTGGATGCCTGCTATTCCTCCGCC
ATCGGCCCCAAGATGCTAGTGGACCTGCTGCTGCCCCGAGCCACCATCCCTTACACAGCC
TGTGCCCTCCAGATGTTTGTCTTTGCAGGTCTGGCTGATACTGAGTGTTGCTTGCTGGCA
GCCATGGCCTATGACCGCTACGTGGCCATCAGAAACCCACTTCTCTATACAACAGCTATG
TCGCAGCGTCTATGCCTGGCCTTGCTGGGAGCATCAGGCCTGGGTGGGGCAGTGAGTGCC
TTTGTTCACACAACCCTCACCTTCCGCCTGAGCTTCTGCCGCTCCCGGAAGATCAATAGC
TTCTTCTGCGATATCCCTCCACTGCTGGCCATCTCGTGCAGTGACACCAGTCTCAATGAA
CTCCTTCTCTTCGCCATCTGTGGCTTCATCCAGACAGCCACGGTGTTAGCTATCACGGTG
TCTTATGGCTTCATCGCTGGGGCTGTGATCCACATGCGCTCGGTCGAGGGCAGTCGGCGA
GCAGCCTCCACCGGTGGTTCCCACCTCACAGCCGTGGCCATGATGTACGGGACACTCATT
TTCATGTACCTGCGCCCCAGCTCCAGCTATGCCCTGGACACTGACAAGATGGCCTCTGTG
TTCTATACCCTGGTCATCCCGTCTCTCAACCCACTCATCTACAGCCTCCGCAATAAGGAG
GTCAAGGAGGCCCTCAGGCAGACCTGGAGCCGATTCCACTGTCCAGGGCAGGGGTCCCAG
Conceptual translation MNSENLTRAAVAPAEFVLLGITNRWDLRVALFLTCLPVYLVSLLGNMGMALLIRMDARLH
TPMYFFLANLSLLDACYSSAIGPKMLVDLLLPRATIPYTACALQMFVFAGLADTECCLLA
AMAYDRYVAIRNPLLYTTAMSQRLCLALLGASGLGGAVSAFVHTTLTFRLSFCRSRKINS
FFCDIPPLLAISCSDTSLNELLLFAICGFIQTATVLAITVSYGFIAGAVIHMRSVEGSRR
AASTGGSHLTAVAMMYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKE
VKEALRQTWSRFHCPGQGSQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS C/G N/K 1000GP (YRI, YRI)
9 100 -100 SYN T/C C/C 1000GP (YRI, YRI)
9 125,551,407 125,551,406 Ins(1) -/T rs34583184 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N5K R93Q F161I R174H V252M % Freq CORP
1 N R F R V 98.16 0.506
2 K R F R V 0.92 0.506
3 N R F H V 0.38 0.506
4 N R F R M 0.23 0.653
5 N Q F R V 0.23 0.506
6 N R I R V 0.08 0.506

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5C1.aApr07-unspliced main_exon 5UTR chr9 122,788,671 122,788,933 +
CDS chr9 122,788,933 122,789,892 +
3UTR chr9 122,789,892 122,789,895 +