Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5D13 Olfactory Receptor

Gene Symbol OR5D131 (View this gene in GeneCards)
Family 5
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR11-142, OR11-148, HsOR11.11.25, ORL3446
External Ids HGNC: 15280   GeneBank: AB065778, BK004333, BK004394, NM_001001967   ORDB: ORL3446   
Build #39 labels OR5D13
Chromosomal location 11:55,773,438-55,774,379 (+)
Cluster 11@56
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs297118)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5D15P 72.96% 307
OR5D2P 69.16% 308
OR5D3P 72.26% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5D13 81% 314
Chimp CONTIG70471.1-471 71% 308
Chimp CONTIG970.47-4272 73% 307
Chimp CONTIG970.55-6311 70% 308
Mouse Or5d45-ps 70% 306
Rat Or5d45-ps 66% 306
Cow OR5D92P 71% 311

Sequence information

Nucleotide sequence ATGATGGCATCTGAAAGAAATCAAAGCAGCACACCCACTTTTATTCTCTTGGGTTTTTCA
GAATACCCAGAAATCCAGGTTCCACTCTTTCTGGTTTTCTTGTTCGTCTACACAGTCACT
GTAGTGGGGAACTTGGGCATGATAATAATCATCAGACTCAATTCAAAACTCCATACAATC
ATGTGCTTTTTCCTTAGTCACTTGTCCTTGACAGACTTCTGTTTTTCCACTGTAGTTACA
CCTAAACTGTTGGAGAACTTGGTTGTGGAATACAGAACCATCTCTTTCTCTGGTTGCATC
ATGCAATTTTGTTTTGCTTGCATTTTTGGAGTGACAGAAACTTTCATGTTAGCAGCGATG
GCTTATGACCGTTTTGTGGCAGTTTGTAAACCCTTGCTGTATACCACTATTATGTCTCAG
AAGCTCTGTGCTCTTCTGGTGGCTGGGTCCTATACATGGGGGATAGTGTGCTCCCTGATA
CTCACATATTTTCTTCTTGACTTATCGTTTTGTGAATCTACCTTCATAAATAATTTTATC
TGTGACCACTCTGTAATTGTTTCTGCCTCCTACTCAGACCCCTATATCAGCCAGAGGCTA
TGCTTTATTATTGCCATATTCAATGAGGTGAGCAGCCTAATTATCATTCTGACATCATAT
ATGCTTATTTTCACTACCATTATGAAGATGCGATCTGCAAGTGGGCGCCAGAAAACTTTC
TCCACCTGTGCCTCCCACCTGACAGCCATCACTATCTTCCATGGAACTATCCTTTTCCTT
TACTGTGTTCCTAATCCTAAAACTTCTAGCCTCATAGTTACAGTGGCTTCTGTGTTTTAC
ACAGTGGCGATTCCAATGCTGAACCCATTGATCTACAGCCTTAGGAACAAAGATATCAAT
AACATGTTTGAAAAATTAGTTGTCACCAAATTGATTTACCAC
Conceptual translation MMASERNQSSTPTFILLGFSEYPEIQVPLFLVFLFVYTVTVVGNLGMIIIIRLNSKLHTI
MCFFLSHLSLTDFCFSTVVTPKLLENLVVEYRTISFSGCIMQFCFACIFGVTETFMLAAM
AYDRFVAVCKPLLYTTIMSQKLCALLVAGSYTWGIVCSLILTYFLLDLSFCESTFINNFI
CDHSVIVSASYSDPYISQRLCFIIAIFNEVSSLIIILTSYMLIFTTIMKMRSASGRQKTF
STCASHLTAITIFHGTILFLYCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDIN
NMFEKLVVTKLIYH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A C/Y 1000GP (YRI, YRI, YRI, YRI)
11 55,541,014 55,541,014 nonsense SNP A/T */L rs11230980 (DbSNP)
11 55,541,098 55,541,098 NS G/A C/Y rs297118 (DbSNP)
11 55,541,284 55,541,284 NS A/G H/R rs11230983 (DbSNP)
11 55,541,620 55,541,620 NS G/T R/L rs7124871 (DbSNP)
11 55,541,807 55,541,807 SYN C/T D/D rs17147848 (DbSNP)
11 55,773,488 55,773,488 NS G/T L/F 1000GP (CEU)
11 55,773,622 55,773,622 NS G/A C/Y 1000GP (CEU, CHBJPT)
11 55,773,808 55,773,808 NS G/A R/H 1000GP (CEU, CHBJPT)
11 55,773,823 55,773,823 NS G/T C/F 1000GP (CHBJPT)
11 55,774,029 55,774,029 nonsense SNP C/T Q/* 1000GP (CHBJPT)
11 55,774,144 55,774,144 NS G/T R/L 1000GP (CEU)
11 55,774,331 55,774,331 SYN T/C D/D 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,382,681 55,548,038 CopyNumber Variation_4743 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,437,126 55,596,313 CopyNumber Variation_48840 (DGV)
11 55,442,368 55,596,313 CopyNumber Variation_48841 (DGV)
11 55,444,868 55,591,047 CopyNumber Variation_48842 (DGV)
11 55,444,868 55,596,313 CopyNumber Variation_48843 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,447,427 55,596,313 CopyNumber Variation_53429 (DGV)
11 55,460,683 55,547,092 CopyNumber Variation_38236 (DGV)
11 55,463,782 55,584,109 CopyNumber Variation_48056 (DGV)
11 55,475,356 55,563,900 CopyNumber Variation_1244 (DGV)
11 55,523,241 55,558,796 CopyNumber Variation_85784 (DGV)
11 55,540,814 55,543,855 Deletion #287 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L17F V36I C62Y A118T R124H Q198* R236L % Freq CORP
1 L V Y A R Q R 82.49 0.534
2 L V Y A H Q R 9.68 0.953
3 L V C A R Q R 3.23 0.946
4 L V Y A R Q L 2.84 0.486
5 L V Y A R * R 0.69 1.200
6 L I Y A R Q R 0.61 0.534
7 L V Y T R Q R 0.15 0.534
8 L I Y A H Q R 0.15 0.953
9 F V Y A R Q R 0.15 0.534

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5D13.aApr07-unspliced main_exon CDS chr11 55,773,438 55,774,379 +
3UTR chr11 55,774,379 55,774,382 +