Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H15 Olfactory Receptor

Gene Symbol OR5H151 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases HsOR3.3.6
External Ids HGNC: 31287   GeneBank: NM_001005515   
Build #39 labels
Chromosomal location 3:98,168,700-98,169,638 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H1 94.57% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 76% 308
Chimp CONTIG405.164-34869 97% 313
Chimp CONTIG405.167-12538 93% 313
Chimp CONTIG405.163-13972 93% 313
Mouse Or5h26 75% 308
Rat Or5h17c 75% 306
Cow OR5H13 77% 308

Sequence information

Nucleotide sequence ATGGAAGAGGAAAATGCAACATTGCTGACAGAGTTTGTTCTCACAGGATTTTTATATCAA
CCACAGTGGAAAATACCCCTGTTCTTGGCATTCTTGGTAATATATCTCATCACCATCATG
GGGAATCTTGGTCTGATTGCTGTCATCTGGAAAGACCCTCACCTTCATATCCCAATGTAC
TTACTCCTTGGGAATTTAGCTTTTGTGGATGCTTGGATATCATCCACAGTGACCCCAAAG
ATGCTGAATAACTTCTTAGCTAAGAGTAAGATGATATCTCTCTCTGAATGCAAGATACAA
TTTTTTTCCATTGCAATTGGCGTAACCACAGAATGTTTTCTCTTGGCAACAATGGCATAT
GATCGCTATGTAGCCATATGCAAACCTTTACTTTATCCAGCCATTATGACCAATGGACTG
TGCATCCGGCTATTAATCTTGTCATATATAGCTGGTATTCTTCATGCTTTAATCCATGAA
GGATTTTTATTCAGACTAACCTTCTGTAACTCCAACATAGTACATCACATTTACTGTGAC
ACTATCCCATTGTCTAAGATTTCTTGTACTGATTCTTCTATTAATTTTCTAATGGTTTTT
ATTTTCTCAGGTTCAATTCAGGTATTCAGCATTGTGACTATTCTTATATCTTACACATTT
GTTCTCTTCACAGTCTTAGAAAAGAAATCTGATAAGGGTGTAAGGAAAGCCTTTTCCACC
TGTGGAGCCCATCTCTTCTCTGTCTGTTTATACTATGGCCCCCTTCTCTTAATGTATGTG
GGCCCTGCATCTCCGCAAGCAGATGGTCAAAATATGGTGGAGCCTCTATTCTACACTGTC
ATCATTCCTTTGTTAAATCCTATCATCTACAGTCTGAGAAATAAGCAAGTCATAGTTTCA
TTCATAAAAATGTTAAAAAGAAATGTTAAGGTTTCATAC
Conceptual translation MEEENATLLTEFVLTGFLYQPQWKIPLFLAFLVIYLITIMGNLGLIAVIWKDPHLHIPMY
LLLGNLAFVDAWISSTVTPKMLNNFLAKSKMISLSECKIQFFSIAIGVTTECFLLATMAY
DRYVAICKPLLYPAIMTNGLCIRLLILSYIAGILHALIHEGFLFRLTFCNSNIVHHIYCD
TIPLSKISCTDSSINFLMVFIFSGSIQVFSIVTILISYTFVLFTVLEKKSDKGVRKAFST
CGAHLFSVCLYYGPLLLMYVGPASPQADGQNMVEPLFYTVIIPLLNPIIYSLRNKQVIVS
FIKMLKRNVKVSY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 NS G/A V/I 1000GP (YRI, YRI)
3 100 -100 SYN C/T G/G 1000GP (YRI, YRI)
3 97,868,973 97,868,973 large insertion 18856bp insertion rs72487696 (DbSNP)
3 97,887,865 97,887,865 NS A/G I/V rs4133320 (DbSNP)
3 97,887,970 97,887,970 SYN A/C R/R rs72933946 (DbSNP)
3 97,887,985 97,887,985 NS A/T T/S rs4133321 (DbSNP)
3 97,887,991 97,887,991 NS A/G I/V rs62269706 (DbSNP)
3 97,887,995 97,887,995 NS C/G A/G rs62269707 (DbSNP)
3 97,887,997 97,887,997 NS C/G R/G rs62266796 (DbSNP)
3 97,888,000 97,888,000 NS A/C I/L rs62266797 (DbSNP)
3 97,888,042 97,888,042 NS A/T T/S rs4133322 (DbSNP)
3 97,888,060 97,888,060 NS A/G I/V rs62266798 (DbSNP)
3 97,888,068 97,888,068 SYN C/T H/H rs62266799 (DbSNP)
3 97,888,085 97,888,085 NS C/T T/I rs62266800 (DbSNP)
3 97,888,164 97,888,164 SYN A/G Q/Q rs62266801 (DbSNP)
3 97,888,167 97,888,167 SYN A/T V/V rs62266802 (DbSNP)
3 97,888,172 97,888,172 NS C/G T/S rs62266803 (DbSNP)
3 97,888,178 97,888,178 NS G/T G/V rs62266804 (DbSNP)
3 97,888,197 97,888,197 SYN C/T Y/Y rs7623031 (DbSNP)
3 97,888,206 97,888,206 SYN C/T V/V rs62266805 (DbSNP)
3 97,888,212 97,888,212 SYN C/T F/F rs62266806 (DbSNP)
3 97,888,216 97,888,216 NS A/G I/V rs62266807 (DbSNP)
3 97,888,323 97,888,322 Ins(1) -/G rs11408838 (DbSNP)
3 97,888,324 97,888,323 Ins(1) -/G rs35671483 (DbSNP)
3 97,888,337 97,888,337 NS C/T P/L rs13082608 (DbSNP)
3 97,888,422 97,888,421 Ins(1) -/G rs34583971 (DbSNP)
3 97,888,438 97,888,438 NS C/G L/V rs72487748 (DbSNP)
3 98,169,021 98,169,021 NS G/A V/I 1000GP (CEU, CHBJPT)
3 98,169,353 98,169,353 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
3 98,169,458 98,169,458 SYN C/A G/G 1000GP (CEU)
3 98,169,493 98,169,493 NS C/T P/L 1000GP (CEU, CHBJPT)
3 98,169,594 98,169,594 NS G/C V/L 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
3 97,874,279 97,931,369 CopyNumber Variation_62080 (DGV)
3 97,887,491 97,919,363 CopyNumber Variation_37833 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C97Y I104F I106T V108I N138T S148T T167S P265L I288V V299L % Freq CORP
1 C I I V N S T P I V 35.02 0.084
2 C I I I N T S L I V 31.34 0.084
3 C I I I N T S P I V 24.73 0.084
4 C I I V N S T P I L 3.53 0.084
5 C F I V N S T P I V 1.69 0.084
6 C I I I N S T P I V 1.00 0.084
7 C I I I N T S L V V 0.84 0.084
8 C I I I T T S P I V 0.31 0.084
9 C I I V N T S L I V 0.31 0.084
10 Y I I V N S T P I V 0.31 0.883
11 C I I I N S S L I V 0.15 0.084
12 C F I V N S S P I V 0.15 0.084
13 Y I I I N T S L I V 0.15 0.883
14 C I I I N S S P I V 0.08 0.084
15 C F I V N T S L I V 0.08 0.084
16 C I T I N T S P I V 0.08 0.084
17 C I I V N S S P I V 0.08 0.084
18 C I I V N S T L I V 0.08 0.084
19 C I I V N T S P I V 0.08 0.084

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5H15.aApr07-unspliced main_exon CDS chr3 98,168,700 98,169,638 +
3UTR chr3 98,169,638 98,169,641 +