Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H2 Olfactory Receptor

Gene Symbol OR5H21 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR3-10, HsOR3.3.12, ORL3093
External Ids HGNC: 14752   GeneBank: AB065666, BK004375, NM_001005482   ORDB: ORL3093   
Build #39 labels OR5H2
Chromosomal location 3:98,282,903-98,283,829 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H1 79.61% 309
OR5H15 78.64% 309
OR5H8P 81.55% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 79% 309
Chimp CONTIG405.181-4276 81% 309
Chimp CONTIG405.171-23594 79% 309
Chimp CONTIG405.163-13972 80% 309
Mouse Or5h18 77% 309
Rat Or5h18 78% 309
Cow OR5H13 78% 308

Expression evidences

Source Accession
ESTs BU565715
mRNA BC104637
GNF Atlas2 gnf1h01993_at

Sequence information

Nucleotide sequence ATGGAACAGGATAATACAACATTGCTGACAGAGTTTGTTCTCACAGGACTTACATATCAG
CCAGAGTGGAAAATGCCCCTGTTCTTGGTGTTCTTGGTGATCTATCTCATCACTATTGTG
TGGAACCTTGGTCTGATTGCTCTTATCTGGAATGACCCACAACTTCACATCCCCATGTAC
TTTTTTCTTGGGAGTTTAGCCTTTGTTGATGCTTGGATATCTTCCACAGTAACTCCCAAA
ATGTTGGTTAATTTCTTGGCCAAAAACAGGATGATATCTCTGTCTGAATGCATGATTCAA
TTTTTTTCCTTTGCATTTGGTGGAACTACAGAATGTTTTCTCTTGGCAACAATGGCATAT
GATCGCTATGTAGCCATATGCAAACCTTTACTATATCCAGTGATTATGAACAATTCACTA
TGCATACGGCTGTTAGCCTTCTCATTTTTAGGTGGCTTCCTCCATGCCTTAATTCATGAA
GTCCTTATATTCAGATTAACCTTCTGCAATTCTAACATAATACATCATTTTTACTGTGAT
ATTATACCACTGTTTATGATTTCCTGTACTGACCCTTCTATTAATTTTCTAATGGTTTTT
ATTTTGTCTGGCTCAATTCAGGTATTCACCATTGTGACAGTTCTTAATTCTTACACATTT
GCTCTTTTCACAATCCTAAAAAAGAAGTCTGTTAGAGGCGTAAGGAAAGCCTTTTCCACC
TGTGGAGCCCATCTCTTATCTGTCTCTTTATATTATGGCCCACTTATCTTCATGTATTTG
CGCCCTGCATCTCCACAAGCAGATGACCAAGATATGATAGACTCTGTCTTTTATACAATC
ATAATTCCTTTGCTAAATCCCATTATCTACAGTCTGAGAAATAAACAAGTAATAGATTCA
TTCACAAAAATGGTAAAAAGAAATGTT
Conceptual translation MEQDNTTLLTEFVLTGLTYQPEWKMPLFLVFLVIYLITIVWNLGLIALIWNDPQLHIPMY
FFLGSLAFVDAWISSTVTPKMLVNFLAKNRMISLSECMIQFFSFAFGGTTECFLLATMAY
DRYVAICKPLLYPVIMNNSLCIRLLAFSFLGGFLHALIHEVLIFRLTFCNSNIIHHFYCD
IIPLFMISCTDPSINFLMVFILSGSIQVFTIVTVLNSYTFALFTILKKKSVRGVRKAFST
CGAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYSLRNKQVIDS
FTKMVKRNV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 98,002,587 98,002,587 NS A/G I/V rs16839611 (DbSNP)
3 98,002,419 98,002,419 NS A/G I/V rs16839214 (DbSNP)
3 98,001,777 98,001,777 NS C/G Q/E rs72487753 (DbSNP)
3 98,002,576 98,002,576 NS C/T S/F rs72934925 (DbSNP)
3 98,002,527 98,002,527 NS C/T R/C rs17787561 (DbSNP)
3 98,002,445 98,002,445 SYN C/T G/G rs72934924 (DbSNP)
3 98,282,933 98,282,933 NS G/C E/Q 1000GP (CEU, CHBJPT)
3 98,283,575 98,283,575 NS A/G I/V 1000GP (CEU, CHBJPT)
3 98,283,743 98,283,743 NS A/G I/V 1000GP (CEU, CHBJPT)
3 100 -100 NS G/C E/Q 1000GP (YRI, YRI, YRI, YRI)
3 100 -100 SYN C/T G/G 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E16Q T43A I230V R266C F282S I286V % Freq CORP
1 E T I R F I 48.00 0.045
2 E T I R F V 35.71 0.045
3 Q T V R F V 13.90 0.045
4 E T I R S V 0.69 0.045
5 E A I R F I 0.69 0.045
6 Q T I R F V 0.31 0.045
7 Q T V R F I 0.31 0.045
8 Q T I R F I 0.23 0.045
9 E T V R F V 0.08 0.045
10 Q T V C F V 0.08 0.045

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5H2.aApr07-unspliced main_exon 5UTR chr3 98,282,888 98,282,903 +
CDS chr3 98,282,903 98,283,829 +
3UTR chr3 98,283,829 98,283,832 +