Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M3 Olfactory Receptor

Gene Symbol OR5M31 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR11-191, HsOR11.11.70, ORL3316, ORL3314
External Ids HGNC: 14806   GeneBank: AB065746, AF399518, BK004498, NM_001004742   ORDB: ORL3316, ORL3314   
Build #39 labels OR5M3
Chromosomal location 11:56,469,577-56,470,497 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M4P 94.81% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M3 91% 307
Chimp CONTIG229.36-29081 93% 307
Mouse Or5m3 92% 306
Mouse Or5m3b 90% 306
Rat Or5m3 92% 306
Cow OR5M3 90% 306
Cow OR5M3DP 87% 305

Expression evidences

Source Accession
mRNA BC136983

Sequence information

Nucleotide sequence ATGCTCAATTTCACCGATGTGACAGAGTTCATTCTTTTGGGGCTAACGAGCCGTCGAGAA
TGGCAAGTTCTCTTCTTCATCATCTTTCTTGTGGTCTACATCATCACCATGGTGGGCAAT
ATCGGCATGATGGTGTTAATCAAGGTCAGTCCTCAGCTTAACAACCCCATGTACTTTTTC
CTCAGTCACTTGTCATTTGTTGATGTGTGGTTTTCTTCCAATGTCACCCCTAAAATGTTG
GAAAACCTGTTATCAGATAAAAAAACAATTACTTATGCTGGTTGTTTAGTACAGTGTTTC
TTCTTCATTGCTCTTGTCCATGTGGAAATTTTTATTCTTGCTGCGATGGCCTTTGATAGA
TACATGGCAATTGGGAATCCTCTGCTTTATGGCAGTAAAATGTCAAGGGTTGTCTGTATT
CGACTGATTACTTTCCCTTACATTTATGGTTTTCTGACGAGTCTGGCAGCAACATTATGG
ACTTACGGCTTGTACTTCTGTGGAAAAATTGAGATCAACCATTTCTACTGTGCAGATCCA
CCTCTCATCAAAATGGCCTGTGCTGGGACCTTTGTAAAAGAATATACAATGATCATACTT
GCCGGCATTAACTTCACATATTCCCTGACTGTAATTATCATCTCTTACTTATTCATCCTC
ATTGCCATTCTGCGAATGCGCTCAGCAGAAGGAAGGCAGAAGGCCTTTTCCACATGTGGG
TCCCATCTGACAGCTGTCATTATATTCTATGGTACTCTGATCTTCATGTATCTCAGACGT
CCCACAGAGGAGTCTGTGGAGCAGGGGAAGATGGTGGCTGTGTTCTATACCACAGTGATC
CCCATGTTGAATCCCATGATCTACAGTCTGAGGAACAAGGATGTGAAAAAGGCCATGATG
AAAGTGATCAGCAGATCATGT
Conceptual translation MLNFTDVTEFILLGLTSRREWQVLFFIIFLVVYIITMVGNIGMMVLIKVSPQLNNPMYFF
LSHLSFVDVWFSSNVTPKMLENLLSDKKTITYAGCLVQCFFFIALVHVEIFILAAMAFDR
YMAIGNPLLYGSKMSRVVCIRLITFPYIYGFLTSLAATLWTYGLYFCGKIEINHFYCADP
PLIKMACAGTFVKEYTMIILAGINFTYSLTVIIISYLFILIAILRMRSAEGRQKAFSTCG
SHLTAVIIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKKAMM
KVISRSC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,237,553 56,237,553 nonsense SNP A/G */R rs72911641 (DbSNP)
11 56,237,722 56,237,722 NS A/T F/L rs605734 (DbSNP)
11 56,237,564 56,237,564 NS A/T V/D rs61902880 (DbSNP)
11 56,237,487 56,237,487 NS C/T G/S rs17150664 (DbSNP)
11 56,237,578 56,237,578 SYN A/G S/S rs61902881 (DbSNP)
11 56,237,410 56,237,410 SYN G/A A/A rs617315 (DbSNP)
11 56,469,934 56,469,934 SYN A/G A/A 1000GP (CEU)
11 56,470,246 56,470,246 NS T/A L/F 1000GP (CEU, CHBJPT)
11 56,470,252 56,470,252 SYN G/A N/N 1000GP (CEU)
11 56,470,011 56,470,011 NS C/T G/S 1000GP (CHBJPT)
11 100 -100 NS T/A L/F 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 30 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G163S T158S L84F V32A N3S % Freq CORP
1 G T L V N 77.80 0.033
2 G T F V N 15.36 0.033
3 G T L V S 4.69 0.033
4 S T L V N 1.92 0.033
5 G T L A N 0.15 0.033
6 G S L V N 0.08 0.033

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5M3.aApr07-unspliced main_exon 3UTR chr11 56,469,574 56,469,577 -
CDS chr11 56,469,577 56,470,497 -