Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M5P Olfactory Receptor

Gene Symbol OR5M5P1 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-198, OR11-192, OR11-187, HsOR11.11.75P, ORL3507
External Ids HGNC: 14810   GeneBank: AB065743, AF399360, BK004644, BK004652, BK004721, NG_004151   ORDB: ORL3507   
Build #39 labels OR5M5P
Chromosomal location 11:56,526,567-56,527,502 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M10 67.32% 306
OR5M11 66.67% 306
OR5M2P 66.03% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M5 91% 312
Chimp CONTIG229.44-17198 97% 312
Mouse Or5m5 90% 312
Rat Or5m5 89% 312
Cow OR5M5 88% 312

Sequence information

Nucleotide sequence ATGGTTAGAGGAAATTCTACTTTGGTGACGGAATTTATTCTCTTGGGATTAAAGGATCTT
CCAGAGCTTCAGCCCATCCTCTTTGTACTGTTCCTGCTAATCTACCTGATCACTGTCGGG
GGGAACCTTGGGATGTTGGTGTTGATCAGGATAGATTCACGCCTCCACACCCCCATGTAT
TTCTTTCTTGCTAGTTTGTCCTGCTTGGATTTGTATTACTCCACTAATGTGACTCCCAAG
ATGTTGGTGAACTTCTTCTCAGACAAGAAAGCCATTTCCTATGCTGCTTGTTTAGTCCAG
TGCTATTTTTTCATTGCTGTGGTGATTACTGAATATTATATGCTAGCTGTAATGGCCTAT
GATAGGTATGTGGCCATCTGTAACCCTTTGCTTTACAGCAGCAAGATGTCCAAAGGGCTC
TGTATTCGCCTGATTGCTGGTCCATATGTCTATGGGTTTCTTAGTGGACTGATGGAAACC
ATGTGGACATACCACTTGACCTTCTGTGGCTCCAATATCATTAATCACTTCTACTGTGCT
GACCCACCCCTCATCCGACTTTCCTGCTCTGACACTTTCATTAAGGAAACATCCATGTTT
GTGGTAGCATGATTTAACCTCTCCAGCTCCCTCATCATAACCCTCATCTCCTACATCTTC
ATTCTCATTGCCATCCTGAGGATGCGTTCTGCTGAAAGTAGGCACAAAGCGTTCTCCACC
TGCGGGTCCCACCTGGTGGCAGTGACTGTGTTTTATGGAACCCTGTTCTGCATGTACGTT
AGACCTCCCACGGACAGGTCAGTGGAACAGTCCAAAGTCATTGCTGTTTTCTACACTTTT
GTAAGCCCTATGTTGAACCCCATCATCTATAGTTTGAGGAACAAGGATGTGAAACAAGCT
TTTTGGAAACTGATCAGAAGAAACGTGCTTTTGAAG
Conceptual translation MVRGNSTLVTEFILLGLKDLPELQPILFVLFLLIYLITVGGNLGMLVLIRIDSRLHTPMY
FFLASLSCLDLYYSTNVTPKMLVNFFSDKKAISYAACLVQCYFFIAVVITEYYMLAVMAY
DRYVAICNPLLYSSKMSKGLCIRLIAGPYVYGFLSGLMETMWTYHLTFCGSNIINHFYCA
DPPLIRLSCSDTFIKETSMFVVAXNLSSSLIITLISYIFILIAILRMRSAESRHKAFST
CGSHLVAVTVFYGTLFCMYVRPPTDRSVEQSKVIAVFYTFVSPMLNPIIYSLRNKDVKQA
FWKLIRRNVLLK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,294,153 56,294,152 Ins(1) -/C rs34275135 (DbSNP)
11 56,294,338 56,294,338 SNP A/G rs646472 (DbSNP)
11 56,294,275 56,294,275 SNP C/T rs658845 (DbSNP)
11 56,294,818 56,294,818 SNP C/T rs637912 (DbSNP)
11 56,294,431 56,294,431 SNP G/T rs1945196 (DbSNP)
11 56,526,799 56,526,799 SNP T/C 1000GP (CEU, CHBJPT)
11 56,526,862 56,526,862 SNP G/A 1000GP (CEU, CHBJPT)
11 56,526,955 56,526,955 SNP G/T 1000GP (CEU, CHBJPT)
11 56,527,342 56,527,342 SNP C/T 1000GP (CEU, CHBJPT)
11 100 -100 SNP G/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 129 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.